"PHF19" Related Products

Recombinant Human PHF19, His-tagged

Cat.No.: PHF19-30329TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-207 of Human PHF19 Isoform 2 with N terminal His tag, Predicted MWt 24 kDa.
Conjugation: HIS
Source: E. coli
Tissue specificity: Isoform 1 is expressed in thymus, heart, lung and kidney. Isoform 2 is predominantly expressed in placenta, skeletal muscle and kidney, whereas isoform 1 is predominantly expressed in liver and peripheral blood leukocytes. Overexpressed in many types of c
Form: Lyophilised:Reconstitute with 107 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodiumphosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MENRALDPGTRDSYGATSHLPNKGALAKVKNNFKDLMSKL TEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNS KYWVLWKDIQHAGVPGEEPKCNICLGKTSGPLNEILIC GKCGLGYHQQCHIPIAGSADQPLLTPWFCRRCIFALAV RVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALETDSASATVLGQDL
Sequence Similarities: Contains 2 PHD-type zinc fingers.
Gene Name: PHF19 PHD finger protein 19 [ Homo sapiens ]
Official Symbol: PHF19
Synonyms: PHF19; PHD finger protein 19; DKFZP727G051; MTF2L1; PCL3; polycomb like 3;
Gene ID: 26147
mRNA Refseq: NM_015651
Protein Refseq: NP_056466
MIM: 609740
Uniprot ID: Q5T6S3
Chromosome Location: 9q34.11
Function: metal ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.