"PLAG1" Related Products

Expand
Expand

Recombinant Human PLAG1

Cat.No.: PLAG1-31026TH
Product Overview: Recombinant fragment corresponding to amino acids 2-99 of Human PLAG1 with a N terminal proprietary tag; predicted MWt 36.41 kDa inclusive of tag; Q6DJT9,
Description: Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene.
Protein length: 98 amino acids
Molecular Weight: 36.410kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in fetal tissues such as lung, liver and kidney. Not detected or weak detection in normal adult tissues, but highly expressed in salivary gland with benign or malignant pleiomorphic adenomas with or without 8q12 abberations, with preferential oc
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK
Sequence Similarities: Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 7 C2H2-type zinc fingers.
Gene Name: PLAG1 pleiomorphic adenoma gene 1 [ Homo sapiens ]
Official Symbol: PLAG1
Synonyms: PLAG1; pleiomorphic adenoma gene 1; zinc finger protein PLAG1; ZNF912;
Gene ID: 5324
mRNA Refseq: NM_001114634
Protein Refseq: NP_001108106
MIM: 603026
Uniprot ID: Q6DJT9
Chromosome Location: 8q12
Function: DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.