Recombinant Human PLAG1
Cat.No. : | PLAG1-31026TH |
Product Overview : | Recombinant fragment corresponding to amino acids 2-99 of Human PLAG1 with a N terminal proprietary tag; predicted MWt 36.41 kDa inclusive of tag; Q6DJT9, |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | Pleomorphic adenoma gene 1 encodes a zinc finger protein with 2 putative nuclear localization signals. PLAG1, which is developmentally regulated, has been shown to be consistently rearranged in pleomorphic adenomas of the salivary glands. PLAG1 is activated by the reciprocal chromosomal translocations involving 8q12 in a subset of salivary gland pleomorphic adenomas. Three transcript variants encoding two different isoforms have been found for this gene. |
Molecular Weight : | 36.410kDa inclusive of tags |
Tissue specificity : | Expressed in fetal tissues such as lung, liver and kidney. Not detected or weak detection in normal adult tissues, but highly expressed in salivary gland with benign or malignant pleiomorphic adenomas with or without 8q12 abberations, with preferential oc |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ATVIPGDLSEVRDTQKVPSGKRKRGETKPRKNFPCQLCDKAFNSVEKLKVHSYSHTGERPYKCIQQDCTKAFVSKYKLQRHMATHSPEKTHKCNYCEK |
Sequence Similarities : | Belongs to the krueppel C2H2-type zinc-finger protein family.Contains 7 C2H2-type zinc fingers. |
Gene Name | PLAG1 pleiomorphic adenoma gene 1 [ Homo sapiens ] |
Official Symbol | PLAG1 |
Synonyms | PLAG1; pleiomorphic adenoma gene 1; zinc finger protein PLAG1; ZNF912; |
Gene ID | 5324 |
mRNA Refseq | NM_001114634 |
Protein Refseq | NP_001108106 |
MIM | 603026 |
Uniprot ID | Q6DJT9 |
Chromosome Location | 8q12 |
Function | DNA binding; metal ion binding; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
PLAG1-31026TH | Recombinant Human PLAG1 | +Inquiry |
PLAG1-2781H | Recombinant Human PLAG1 protein, His-tagged | +Inquiry |
PLAG1-6810M | Recombinant Mouse PLAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAG1-4153R | Recombinant Rat PLAG1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLAG1-301522H | Recombinant Human PLAG1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLAG1-3134HCL | Recombinant Human PLAG1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLAG1 Products
Required fields are marked with *
My Review for All PLAG1 Products
Required fields are marked with *