"PMF1" Related Products

Recombinant Human PMF1, His-tagged

Cat.No.: PMF1-27991TH
Product Overview: Recombinant fragment, corresponding to amino acids 26-205 of Human NNF1R with N terminal His tag; 180 amino acids, 29kDa.
Description: NNF1R, also called PMF1, is part of the MIS12 complex, which may be fundamental for kinetochore formation and proper chromosome segregation during mitosis. It is required for chromosome congressionand for correct operation of the spindle checkpoint. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 52 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCF YQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEA VLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYF LQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQ VQAQQQAWQALHREQRELVAVLREPE
Gene Name: PMF1 polyamine-modulated factor 1 [ Homo sapiens ]
Official Symbol: PMF1
Synonyms: PMF1; polyamine-modulated factor 1;
Gene ID: 11243
mRNA Refseq: NM_001199653
Protein Refseq: NP_001186582
MIM: 609176
Uniprot ID: Q6P1K2
Chromosome Location: 1q22
Pathway: Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; M Phase, organism-specific biosystem; Mitotic M-M/G1 phases, organism-specific biosystem; Mitotic Prometaphase, organism-specific biosystem;
Function: leucine zipper domain binding; protein binding; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.