Recombinant Human POLR3D

Cat.No. : POLR3D-30686TH
Product Overview : Recombinant fragment corresponding to amino acids 296-395 of Human POLR3D with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH
Gene Name POLR3D polymerase (RNA) III (DNA directed) polypeptide D, 44kDa [ Homo sapiens ]
Official Symbol POLR3D
Synonyms POLR3D; polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; BN51 (BHK21) temperature sensitivity complementing , BN51T; DNA-directed RNA polymerase III subunit RPC4; RPC4; TSBN51;
Gene ID 661
mRNA Refseq NM_001722
Protein Refseq NP_001713
Uniprot ID P05423
Chromosome Location 8q21
Pathway Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem;
Function DNA binding; DNA-directed RNA polymerase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All POLR3D Products

Required fields are marked with *

My Review for All POLR3D Products

Required fields are marked with *

0
cart-icon
0
compare icon