"POLR3D" Related Products

Expand

Recombinant Human POLR3D

Cat.No. : POLR3D-30686TH
Product Overview : Recombinant fragment corresponding to amino acids 296-395 of Human POLR3D with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description : This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures.
Protein length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH
Gene Name : POLR3D polymerase (RNA) III (DNA directed) polypeptide D, 44kDa [ Homo sapiens ]
Official Symbol : POLR3D
Synonyms : POLR3D; polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; BN51 (BHK21) temperature sensitivity complementing , BN51T; DNA-directed RNA polymerase III subunit RPC4; RPC4; TSBN51;
Gene ID : 661
mRNA Refseq : NM_001722
Protein Refseq : NP_001713
Uniprot ID : P05423
Chromosome Location : 8q21
Pathway : Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem;
Function : DNA binding; DNA-directed RNA polymerase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.