Recombinant Human POLR3D

• Cat.No.: POLR3D-30686TH
• Product Overview: Recombinant fragment corresponding to amino acids 296-395 of Human POLR3D with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures.
• Molecular Weight: 36.630kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH

Gene Information

• Gene Name: POLR3D polymerase (RNA) III (DNA directed) polypeptide D, 44kDa [ Homo sapiens ]
• Official Symbol: POLR3D
• Synonyms: POLR3D; polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; BN51 (BHK21) temperature sensitivity complementing , BN51T; DNA-directed RNA polymerase III subunit RPC4; RPC4; TSBN51
• Gene ID: 661
• mRNA Refseq: NM_001722
• Protein Refseq: NP_001713
• Uniprot ID: P05423
• Chromosome Location: 8q21
• Pathway: Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem
• Function: DNA binding; DNA-directed RNA polymerase activity