Recombinant Human POLR3D
Cat.No. : | POLR3D-30686TH |
Product Overview : | Recombinant fragment corresponding to amino acids 296-395 of Human POLR3D with an N terminal proprietary tag; Predicted MWt 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene complements a temperature-sensitive mutant isolated from the BHK-21 Syrian hamster cell line. It leads to a block in progression through the G1 phase of the cell cycle at nonpermissive temperatures. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GQVVLIKQEKDREAKLAENACTLADLTEGQVGKLLIRKSGRVQLLLGKVTLDVTMGTACSFLQELVSVGLGDSRTGEMTVLGHVKHKLVCSPDFESLLDH |
Gene Name | POLR3D polymerase (RNA) III (DNA directed) polypeptide D, 44kDa [ Homo sapiens ] |
Official Symbol | POLR3D |
Synonyms | POLR3D; polymerase (RNA) III (DNA directed) polypeptide D, 44kDa; BN51 (BHK21) temperature sensitivity complementing , BN51T; DNA-directed RNA polymerase III subunit RPC4; RPC4; TSBN51; |
Gene ID | 661 |
mRNA Refseq | NM_001722 |
Protein Refseq | NP_001713 |
Uniprot ID | P05423 |
Chromosome Location | 8q21 |
Pathway | Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Eukaryotic Transcription Initiation, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; |
Function | DNA binding; DNA-directed RNA polymerase activity; |
◆ Recombinant Proteins | ||
POLR3D-1850H | Recombinant Human POLR3D, His-tagged | +Inquiry |
POLR3D-13107M | Recombinant Mouse POLR3D Protein | +Inquiry |
POLR3D-10619Z | Recombinant Zebrafish POLR3D | +Inquiry |
Polr3d-5005M | Recombinant Mouse Polr3d Protein, Myc/DDK-tagged | +Inquiry |
POLR3D-30686TH | Recombinant Human POLR3D | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR3D-3025HCL | Recombinant Human POLR3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All POLR3D Products
Required fields are marked with *
My Review for All POLR3D Products
Required fields are marked with *