Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human POMGNT1, His-tagged

Cat.No. : POMGNT1-27934TH
Product Overview : Recombinant fragment, corresponding to amino acids 408-660 of Human POMGNT1 with N terminal His tag; 42 kDa ;
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a type II transmembrane protein that resides in the golgi. It participates in O-mannosyl glycosylation, and is specific for alpha linked terminal mannose. Mutations in this gene are associated with muscle-eye-brain (MEB) disease. Alternatively spliced transcript variants have been found for this gene.
Conjugation : HIS
Source : E. coli
Tissue specificity : Constitutively expressed. An additional weaker band is also detected in spinal cord, lymph node, and trachea. Expressed especially in astrocytes. Also expressed in immature and mature neurons.
Form : Lyophilised:Reconstitute with 32 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMP GLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQR RGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFN TVPGVQLRNVDSLKKEAYEVEVHRLLSEAEVLDHSKNP CEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLHIWD LDVRGNHRGLWRLFRKKNHFLVVGVPASPYSVKKPPSV TPIFLEPPPKEEGAPGAPEQT
Sequence Similarities : Belongs to the glycosyltransferase 13 family.
Gene Name : POMGNT1 protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase [ Homo sapiens ]
Official Symbol : POMGNT1
Synonyms : POMGNT1; protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase; protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; FLJ20277; MGAT1.2; protein O mannose beta 1; 2 N acetylglucosaminyltransferase;
Gene ID : 55624
mRNA Refseq : NM_001243766
Protein Refseq : NP_001230695
MIM : 606822
Uniprot ID : Q8WZA1
Chromosome Location : 1p34.1
Pathway : Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem;
Function : alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All POMGNT1 Products

Required fields are marked with *

My Review for All POMGNT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends