Recombinant Human POMGNT1, His-tagged

• Cat.No.: POMGNT1-27934TH
• Product Overview: Recombinant fragment, corresponding to amino acids 408-660 of Human POMGNT1 with N terminal His tag; 42 kDa

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 408-660 a.a.
• Description: The protein encoded by this gene is a type II transmembrane protein that resides in the golgi. It participates in O-mannosyl glycosylation, and is specific for alpha linked terminal mannose. Mutations in this gene are associated with muscle-eye-brain (MEB) disease. Alternatively spliced transcript variants have been found for this gene.
• Conjugation: HIS
• Tissue specificity: Constitutively expressed. An additional weaker band is also detected in spinal cord, lymph node, and trachea. Expressed especially in astrocytes. Also expressed in immature and mature neurons.
• Form: Lyophilised:Reconstitute with 32 μl distilled water.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: QSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMP GLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQR RGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFN TVPGVQLRNVDSLKKEAYEVEVHRLLSEAEVLDHSKNP CEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLHIWD LDVRGNHRGLWRLFRKKNHFLVVGVPASPYSVKKPPSV TPIFLEPPPKEEGAPGAPEQT
• Sequence Similarities: Belongs to the glycosyltransferase 13 family.

Gene Information

• Gene Name: POMGNT1 protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase [ Homo sapiens ]
• Official Symbol: POMGNT1
• Synonyms: POMGNT1; protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase; protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1; FLJ20277; MGAT1.2; protein O mannose beta 1; 2 N acetylglucosaminyltransferase
• Gene ID: 55624
• mRNA Refseq: NM_001243766
• Protein Refseq: NP_001230695
• MIM: 606822
• Uniprot ID: Q8WZA1
• Chromosome Location: 1p34.1
• Pathway: Other types of O-glycan biosynthesis, organism-specific biosystem; Other types of O-glycan biosynthesis, conserved biosystem
• Function: alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups