"PPP2R5C" Related Products

Expand

Recombinant Human PPP2R5C

Cat.No.: PPP2R5C-29538TH
Product Overview: Recombinant fragment corresponding to amino acids 1-100 of Human PPP2R5C with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highest levels in heart, skeletal muscle and brain. Lower levels in pancreas, kidney, lung and placenta. Very low levels in liver.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Sequence Similarities: Belongs to the phosphatase 2A regulatory subunit B56 family.
Gene Name: PPP2R5C protein phosphatase 2, regulatory subunit B, gamma [ Homo sapiens ]
Official Symbol: PPP2R5C
Synonyms: PPP2R5C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2, regulatory subunit B (B56), gamma isoform , protein phosphatase 2, regulatory subunit B, gamma isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
Gene ID: 5527
mRNA Refseq: NM_001161725
Protein Refseq: NP_001155197
MIM: 601645
Uniprot ID: Q13362
Chromosome Location: 14q32.31
Pathway: Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem;
Function: binding; peptidase activity; protein binding; protein phosphatase type 2A regulator activity; protein phosphatase type 2A regulator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.