Recombinant Human PPP2R5C

Cat.No. : PPP2R5C-29538TH
Product Overview : Recombinant fragment corresponding to amino acids 1-100 of Human PPP2R5C with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a gamma isoform of the regulatory subunit B56 subfamily. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Highest levels in heart, skeletal muscle and brain. Lower levels in pancreas, kidney, lung and placenta. Very low levels in liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA
Sequence Similarities : Belongs to the phosphatase 2A regulatory subunit B56 family.
Gene Name PPP2R5C protein phosphatase 2, regulatory subunit B, gamma [ Homo sapiens ]
Official Symbol PPP2R5C
Synonyms PPP2R5C; protein phosphatase 2, regulatory subunit B, gamma; protein phosphatase 2, regulatory subunit B (B56), gamma isoform , protein phosphatase 2, regulatory subunit B, gamma isoform; serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
Gene ID 5527
mRNA Refseq NM_001161725
Protein Refseq NP_001155197
MIM 601645
Uniprot ID Q13362
Chromosome Location 14q32.31
Pathway Adaptive Immune System, organism-specific biosystem; Beta-catenin phosphorylation cascade, organism-specific biosystem; CTLA4 inhibitory signaling, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem;
Function binding; peptidase activity; protein binding; protein phosphatase type 2A regulator activity; protein phosphatase type 2A regulator activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PPP2R5C Products

Required fields are marked with *

My Review for All PPP2R5C Products

Required fields are marked with *

0
cart-icon