Recombinant Human PRELP
| Cat.No. : | PRELP-30073TH |
| Product Overview : | Recombinant fragment corresponding to amino acids 281-365 of Human PRELP, with a N terminal proprietary tag; predicted MW: 34.98 kDa inclusive of tag. P51888, |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 85 amino acids |
| Description : | The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed. |
| Molecular Weight : | 34.980kDa inclusive of tags |
| Tissue specificity : | Connective tissue. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP |
| Sequence Similarities : | Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class II subfamily.Contains 12 LRR (leucine-rich) repeats. |
| Gene Name | PRELP proline/arginine-rich end leucine-rich repeat protein [ Homo sapiens ] |
| Official Symbol | PRELP |
| Synonyms | PRELP; proline/arginine-rich end leucine-rich repeat protein; proline arginine rich end leucine rich repeat protein; prolargin; prolargin proteoglycan; SLRR2A; |
| Gene ID | 5549 |
| mRNA Refseq | NM_002725 |
| Protein Refseq | NP_002716 |
| MIM | 601914 |
| Uniprot ID | P51888 |
| Chromosome Location | 1q32 |
| Function | extracellular matrix structural constituent; heparin binding; |
| ◆ Recombinant Proteins | ||
| PRELP-4664R | Recombinant Rat PRELP Protein | +Inquiry |
| PRELP-4323R | Recombinant Rat PRELP Protein, His (Fc)-Avi-tagged | +Inquiry |
| PRELP-2906H | Recombinant Human PRELP Protein, MYC/DDK-tagged | +Inquiry |
| Prelp-579M | Recombinant Mouse Prelp Protein, MYC/DDK-tagged | +Inquiry |
| PRELP-6145H | Recombinant Human PRELP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRELP-002HCL | Recombinant Human PRELP cell lysate | +Inquiry |
| PRELP-001HCL | Recombinant Human PRELP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRELP Products
Required fields are marked with *
My Review for All PRELP Products
Required fields are marked with *
