Recombinant Human PRKX

Cat.No. : PRKX-30107TH
Product Overview : Recombinant fragment of Human PRKX with N terminal proprietary tag, 35.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein may also be involved in macrophage and granulocyte maturation. Abnormal recombination between this gene and a related pseudogene on chromosome Y is a frequent cause of sex reversal disorder in XX males and XY females. Pseudogenes of this gene are found on chromosomes X, 15 and Y.
Molecular Weight : 35.530kDa inclusive of tags
Tissue specificity : High levels in adult and fetal brain, kidney and lung; low levels in adult placenta, heart, liver, skeletal muscle, pancreas and fetal liver.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FHVKDLIKKLLVVDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQKDLEIFKNF
Sequence Similarities : Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. cAMP subfamily.Contains 1 AGC-kinase C-terminal domain.Contains 1 protein kinase domain.
Gene Name PRKX protein kinase, X-linked [ Homo sapiens ]
Official Symbol PRKX
Synonyms PRKX; protein kinase, X-linked; cAMP-dependent protein kinase catalytic subunit PRKX; PKX1;
Gene ID 5613
mRNA Refseq NM_005044
Protein Refseq NP_005035
MIM 300083
Uniprot ID P51817
Chromosome Location Xp22.3
Pathway Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Bile secretion, organism-specific biosystem;
Function ATP binding; cAMP-dependent protein kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRKX Products

Required fields are marked with *

My Review for All PRKX Products

Required fields are marked with *

0
cart-icon