"PRRX1" Related Products

Expand

Recombinant Human PRRX1

Cat.No.: PRRX1-31000TH
Product Overview: Recombinant full length Human PRRX1, isoform PMX1-A with N terminal proprietary tag; Predicted MWt 49.94 kDa.
Description: The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns.
Protein length: 217 amino acids
Molecular Weight: 49.940kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLL DLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD NDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANK NASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYR SSSLPRCCLHEGLHNGF
Sequence Similarities: Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain.
Gene Name: PRRX1 paired related homeobox 1 [ Homo sapiens ]
Official Symbol: PRRX1
Synonyms: PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1;
Gene ID: 5396
mRNA Refseq: NM_006902
Protein Refseq: NP_008833
MIM: 167420
Uniprot ID: P54821
Chromosome Location: 1q24.3
Function: sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.