Recombinant Human PRRX1
Cat.No. : | PRRX1-31000TH |
Product Overview : | Recombinant full length Human PRRX1, isoform PMX1-A with N terminal proprietary tag; Predicted MWt 49.94 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. |
Protein length : | 217 amino acids |
Molecular Weight : | 49.940kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLL DLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD NDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANK NASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYR SSSLPRCCLHEGLHNGF |
Sequence Similarities : | Belongs to the paired homeobox family.Contains 1 homeobox DNA-binding domain. |
Gene Name : | PRRX1 paired related homeobox 1 [ Homo sapiens ] |
Official Symbol : | PRRX1 |
Synonyms : | PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1; |
Gene ID : | 5396 |
mRNA Refseq : | NM_006902 |
Protein Refseq : | NP_008833 |
MIM : | 167420 |
Uniprot ID : | P54821 |
Chromosome Location : | 1q24.3 |
Function : | sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
Products Types
◆ Recombinant Protein | ||
PRRX1-4394R | Recombinant Rat PRRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRRX1-2787H | Recombinant Human PRRX1 protein(11-80 aa), C-His-tagged | +Inquiry |
PRRX1-3924H | Recombinant Human PRRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Prrx1-5162M | Recombinant Mouse Prrx1 Protein, Myc/DDK-tagged | +Inquiry |
PRRX1-30707TH | Recombinant Human PRRX1 | +Inquiry |
◆ Lysates | ||
PRRX1-2807HCL | Recombinant Human PRRX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket