Recombinant Full Length Human PRRX1 Protein
Cat.No. : | PRRX1-427HF |
Product Overview : | Recombinant full length Human PRRX1, isoform PMX1-A with N terminal proprietary tag; Predicted MWt 49.94 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 217 amino acids |
Description : | The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. |
Form : | Liquid |
Molecular Mass : | 49.940kDa inclusive of tags |
AA Sequence : | MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLL DLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD NDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANK NASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYR SSSLPRCCLHEGLHNGF |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PRRX1 paired related homeobox 1 [ Homo sapiens ] |
Official Symbol | PRRX1 |
Synonyms | PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1 |
Gene ID | 5396 |
mRNA Refseq | NM_006902 |
Protein Refseq | NP_008833 |
MIM | 167420 |
UniProt ID | P54821 |
◆ Recombinant Proteins | ||
PRRX1-3924H | Recombinant Human PRRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRRX1-1747C | Recombinant Chicken PRRX1 | +Inquiry |
Prrx1-5162M | Recombinant Mouse Prrx1 Protein, Myc/DDK-tagged | +Inquiry |
PRRX1-4394R | Recombinant Rat PRRX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRRX1-317H | Recombinant Human PRRX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRRX1-2807HCL | Recombinant Human PRRX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRRX1 Products
Required fields are marked with *
My Review for All PRRX1 Products
Required fields are marked with *