Recombinant Full Length Human PRRX1 Protein
| Cat.No. : | PRRX1-427HF |
| Product Overview : | Recombinant full length Human PRRX1, isoform PMX1-A with N terminal proprietary tag; Predicted MWt 49.94 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 217 amino acids |
| Description : | The DNA-associated protein encoded by this gene is a member of the paired family of homeobox proteins localized to the nucleus. The protein functions as a transcription co-activator, enhancing the DNA-binding activity of serum response factor, a protein required for the induction of genes by growth and differentiation factors. The protein regulates muscle creatine kinase, indicating a role in the establishment of diverse mesodermal muscle types. Alternative splicing yields two isoforms that differ in abundance and expression patterns. |
| Form : | Liquid |
| Molecular Mass : | 49.940kDa inclusive of tags |
| AA Sequence : | MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLL DLEEAGDMVAAQADENVGEAGRSLLESPGLTSGSDTPQQD NDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANK NASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYR SSSLPRCCLHEGLHNGF |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | PRRX1 paired related homeobox 1 [ Homo sapiens ] |
| Official Symbol | PRRX1 |
| Synonyms | PRRX1; paired related homeobox 1; paired mesoderm homeo box 1 , PMX1; paired mesoderm homeobox protein 1; PHOX1 |
| Gene ID | 5396 |
| mRNA Refseq | NM_006902 |
| Protein Refseq | NP_008833 |
| MIM | 167420 |
| UniProt ID | P54821 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRRX1 Products
Required fields are marked with *
My Review for All PRRX1 Products
Required fields are marked with *



