Recombinant Human PTGIS

Cat.No. : PTGIS-30324TH
Product Overview : Recombinant fragment of Human PTGIS with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 110 amino acids
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis.
Molecular Weight : 37.730kDa inclusive of tags
Tissue specificity : Widely expressed; particularly abundant in ovary, heart, skeletal muscle, lung and prostate.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNY NMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINAD VEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
Sequence Similarities : Belongs to the cytochrome P450 family.
Gene Name PTGIS prostaglandin I2 (prostacyclin) synthase [ Homo sapiens ]
Official Symbol PTGIS
Synonyms PTGIS; prostaglandin I2 (prostacyclin) synthase; prostacyclin synthase; CYP8A1; cytochrome P450; family 8; subfamily A; polypeptide 1; PGIS;
Gene ID 5740
mRNA Refseq NM_000961
Protein Refseq NP_000952
MIM 601699
Uniprot ID Q16647
Chromosome Location 20q13
Pathway Adipogenesis, organism-specific biosystem; Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem;
Function electron carrier activity; heme binding; isomerase activity; metal ion binding; monooxygenase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PTGIS Products

Required fields are marked with *

My Review for All PTGIS Products

Required fields are marked with *

0
cart-icon