Recombinant Human PTGIS
Cat.No. : | PTGIS-30324TH |
Product Overview : | Recombinant fragment of Human PTGIS with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed; particularly abundant in ovary, heart, skeletal muscle, lung and prostate. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNY NMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINAD VEIPEFDLSRYGFGLMQPEHDVPVRYRIRP |
Sequence Similarities : | Belongs to the cytochrome P450 family. |
Gene Name : | PTGIS prostaglandin I2 (prostacyclin) synthase [ Homo sapiens ] |
Official Symbol : | PTGIS |
Synonyms : | PTGIS; prostaglandin I2 (prostacyclin) synthase; prostacyclin synthase; CYP8A1; cytochrome P450; family 8; subfamily A; polypeptide 1; PGIS; |
Gene ID : | 5740 |
mRNA Refseq : | NM_000961 |
Protein Refseq : | NP_000952 |
MIM : | 601699 |
Uniprot ID : | Q16647 |
Chromosome Location : | 20q13 |
Pathway : | Adipogenesis, organism-specific biosystem; Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem; |
Function : | electron carrier activity; heme binding; isomerase activity; metal ion binding; monooxygenase activity; |
Products Types
◆ Recombinant Protein | ||
PTGIS-4472R | Recombinant Rat PTGIS Protein, His (Fc)-Avi-tagged | +Inquiry |
PTGIS-1793H | Recombinant Human PTGIS Protein, His (Fc)-Avi-tagged | +Inquiry |
Ptgis-5222M | Recombinant Mouse Ptgis Protein, Myc/DDK-tagged | +Inquiry |
PTGIS-830H | Recombinant Human PTGIS protein, His-tagged | +Inquiry |
PTGIS-2970H | Recombinant Human PTGIS protein, His-tagged | +Inquiry |
◆ Lysates | ||
PTGIS-2709HCL | Recombinant Human PTGIS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket