Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PTGIS

Cat.No. : PTGIS-30324TH
Product Overview : Recombinant fragment of Human PTGIS with a N terminal proprietary tag: predicted molecular weight 37.73 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to prostacyclin (prostaglandin I2), a potent vasodilator and inhibitor of platelet aggregation. An imbalance of prostacyclin and its physiological antagonist thromboxane A2 contribute to the development of myocardial infarction, stroke, and atherosclerosis.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed; particularly abundant in ovary, heart, skeletal muscle, lung and prostate.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PQRDPEIYTDPEVFKYNRFLNPDGSEKKDFYKDGKRLKNY NMPWGAGHNHCLGRSYAVNSIKQFVFLVLVHLDLELINAD VEIPEFDLSRYGFGLMQPEHDVPVRYRIRP
Sequence Similarities : Belongs to the cytochrome P450 family.
Gene Name : PTGIS prostaglandin I2 (prostacyclin) synthase [ Homo sapiens ]
Official Symbol : PTGIS
Synonyms : PTGIS; prostaglandin I2 (prostacyclin) synthase; prostacyclin synthase; CYP8A1; cytochrome P450; family 8; subfamily A; polypeptide 1; PGIS;
Gene ID : 5740
mRNA Refseq : NM_000961
Protein Refseq : NP_000952
MIM : 601699
Uniprot ID : Q16647
Chromosome Location : 20q13
Pathway : Adipogenesis, organism-specific biosystem; Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Biological oxidations, organism-specific biosystem; Cytochrome P450 - arranged by substrate type, organism-specific biosystem;
Function : electron carrier activity; heme binding; isomerase activity; metal ion binding; monooxygenase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends