Recombinant Human PTRH2, His-tagged
Cat.No. : | PTRH2-31259TH |
Product Overview : | Recombinant full lenght Human PTRH2 with an N terminal His tag; 137aa, 14.9kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 116 amino acids |
Description : | PTRH2 (peptidyl-tRNA hydrolase 2), also known as BIT1, is a mitochondrial protein. During apoptosis, PTRH2 is released from the mitochondria to the cytoplasm. |
Conjugation : | HIS |
Molecular Weight : | 14.900kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | Preservative: 0% NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0 |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY |
Sequence Similarities : | Belongs to the PTH2 family. |
Gene Name | PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ] |
Official Symbol | PTRH2 |
Synonyms | PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2; |
Gene ID | 51651 |
mRNA Refseq | NM_016077 |
Protein Refseq | NP_057161 |
MIM | 608625 |
Uniprot ID | Q9Y3E5 |
Chromosome Location | 17q23.2 |
Function | aminoacyl-tRNA hydrolase activity; hydrolase activity; |
◆ Recombinant Proteins | ||
PTRH2-3527R | Recombinant Rhesus Macaque PTRH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTRH2-392H | Recombinant Human PTRH2 protein, His-tagged | +Inquiry |
PTRH2-335H | Recombinant Human PTRH2 protein, GST-tagged | +Inquiry |
PTRH2-1642HF | Recombinant Full Length Human PTRH2 Protein, GST-tagged | +Inquiry |
PTRH2-235H | Recombinant Human PTRH2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTRH2-2669HCL | Recombinant Human PTRH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTRH2 Products
Required fields are marked with *
My Review for All PTRH2 Products
Required fields are marked with *