"PTRH2" Related Products

Expand
Expand

Recombinant Human PTRH2, His-tagged

Cat.No.: PTRH2-31259TH
Product Overview: Recombinant full lenght Human PTRH2 with an N terminal His tag; 137aa, 14.9kDa inclusive of tag.
Description: PTRH2 (peptidyl-tRNA hydrolase 2), also known as BIT1, is a mitochondrial protein. During apoptosis, PTRH2 is released from the mitochondria to the cytoplasm.
Protein length: 116 amino acids
Conjugation: HIS
Molecular Weight: 14.900kDa inclusive of tags
Source: E. coli
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: 0% NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY
Sequence Similarities: Belongs to the PTH2 family.
Gene Name: PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ]
Official Symbol: PTRH2
Synonyms: PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2;
Gene ID: 51651
mRNA Refseq: NM_016077
Protein Refseq: NP_057161
MIM: 608625
Uniprot ID: Q9Y3E5
Chromosome Location: 17q23.2
Function: aminoacyl-tRNA hydrolase activity; hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.