Recombinant Human PTRH2 protein, GST-tagged
| Cat.No. : | PTRH2-335H |
| Product Overview : | Recombinant Human PTRH2 protein(NP_057161)(1-180 aa), fused to GST tag, was expressed in E. coli. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-180 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Gene Name | PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ] |
| Official Symbol | PTRH2 |
| Synonyms | PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2; PTH 2; bcl-2 inhibitor of transcription 1; CGI-147; FLJ32471; |
| Gene ID | 51651 |
| mRNA Refseq | NM_016077 |
| Protein Refseq | NP_057161 |
| MIM | 608625 |
| UniProt ID | Q9Y3E5 |
| ◆ Recombinant Proteins | ||
| PTRH2-392H | Recombinant Human PTRH2 protein, His-tagged | +Inquiry |
| PTRH2-335H | Recombinant Human PTRH2 protein, GST-tagged | +Inquiry |
| PTRH2-3710R | Recombinant Rhesus monkey PTRH2 Protein, His-tagged | +Inquiry |
| PTRH2-1642HF | Recombinant Full Length Human PTRH2 Protein, GST-tagged | +Inquiry |
| PTRH2-3411C | Recombinant Chicken PTRH2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PTRH2-2669HCL | Recombinant Human PTRH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PTRH2 Products
Required fields are marked with *
My Review for All PTRH2 Products
Required fields are marked with *
