Recombinant Human PTRH2 protein, GST-tagged
Cat.No. : | PTRH2-335H |
Product Overview : | Recombinant Human PTRH2 protein(NP_057161)(1-180 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-180 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MPSKSLVMEYLAHPSTLGLAVGVACGMCLGWSLRVCFGMLPKSKTSKTHTDTESEASILGDSGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPEMLKQWEYCGQPKVVVKAPDEETLIALLAHAKMLGLTVSLIQDAGRTQIAPGSQTVLGIGPGPADLIDKVTGHLKLY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | PTRH2 peptidyl-tRNA hydrolase 2 [ Homo sapiens ] |
Official Symbol | PTRH2 |
Synonyms | PTRH2; peptidyl-tRNA hydrolase 2; peptidyl-tRNA hydrolase 2, mitochondrial; Bcl 2 inhibitor of transcription; BIT1; CGI 147; PTH2; PTH 2; bcl-2 inhibitor of transcription 1; CGI-147; FLJ32471; |
Gene ID | 51651 |
mRNA Refseq | NM_016077 |
Protein Refseq | NP_057161 |
MIM | 608625 |
UniProt ID | Q9Y3E5 |
◆ Recombinant Proteins | ||
PTRH2-3527R | Recombinant Rhesus Macaque PTRH2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PTRH2-8601H | Recombinant Human PTRH2, His tagged | +Inquiry |
PTRH2-2728Z | Recombinant Zebrafish PTRH2 | +Inquiry |
PTRH2-335H | Recombinant Human PTRH2 protein, GST-tagged | +Inquiry |
PTRH2-1642HF | Recombinant Full Length Human PTRH2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTRH2-2669HCL | Recombinant Human PTRH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PTRH2 Products
Required fields are marked with *
My Review for All PTRH2 Products
Required fields are marked with *
0
Inquiry Basket