"RAD51C" Related Products

Expand

Recombinant Human RAD51C

Cat.No.: RAD51C-28601TH
Product Overview: Recombinant fragment of Human Rad51C with a N terminal proprietary tag; Predicted MWt 40.48 kDa including the tag.
Description: This gene is a member of the RAD51 family of related genes, which encode strand-transfer proteins thought to be involved in recombinational repair of damaged DNA and in meiotic recombination. This gene product interacts with two other DNA repair proteins, encoded by RAD51B and XRCC3, but not with itself. The protein copurifies with XRCC3 protein in a complex, reflecting their endogenous association and suggesting a cooperative role during recombinational repair. This gene is one of four localized to a region of chromosome 17q23 where amplification occurs frequently in breast tumors. Overexpression of the four genes during amplification has been observed and suggests a possible role in tumor progression. Alternative splicing has been observed for this gene and two variants encoding different isoforms have been identified.
Protein length: 134 amino acids
Molecular Weight: 40.480kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQL
Gene Name: RAD51C RAD51 homolog C (S. cerevisiae) [ Homo sapiens ]
Official Symbol: RAD51C
Synonyms: RAD51C; RAD51 homolog C (S. cerevisiae); RAD51 (S. cerevisiae) homolog C; DNA repair protein RAD51 homolog 3; RAD51L2;
Gene ID: 5889
mRNA Refseq: NM_002876
Protein Refseq: NP_002867
MIM: 602774
Uniprot ID: O43502
Chromosome Location: 17q25.1
Pathway: Factors involved in megakaryocyte development and platelet production, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem; Fanconi anemia pathway, conserved biosystem; Hemostasis, organism-specific biosystem; Homologous recombination, organism-specific biosystem;
Function: ATP binding; DNA binding; DNA-dependent ATPase activity; crossover junction endodeoxyribonuclease activity; nucleoside-triphosphatase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.