"RARRES1" Related Products

Expand

Recombinant Human RARRES1

Cat.No.: RARRES1-31292TH
Product Overview: Recombinant full length Human RARRES1, isoform 1 with N terminal proprietary tag, 50.71kDa.
Description: This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed.
Protein length: 228 amino acids
Molecular Weight: 50.710kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGS GDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSAL RVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYL LYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSS YVMWEMTTQVSHYYLAQLTSVRQWVRKT
Sequence Similarities: Belongs to the protease inhibitor I47 (latexin) family.
Gene Name: RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ]
Official Symbol: RARRES1
Synonyms: RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1;
Gene ID: 5918
mRNA Refseq: NM_002888
Protein Refseq: NP_002879
MIM: 605090
Uniprot ID: P49788
Chromosome Location: 3q25.32

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.