Recombinant Human RARRES1
Cat.No. : | RARRES1-31292TH |
Product Overview : | Recombinant full length Human RARRES1, isoform 1 with N terminal proprietary tag, 50.71kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed. |
Protein length : | 228 amino acids |
Molecular Weight : | 50.710kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGS GDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSAL RVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYL LYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSS YVMWEMTTQVSHYYLAQLTSVRQWVRKT |
Sequence Similarities : | Belongs to the protease inhibitor I47 (latexin) family. |
Gene Name : | RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ] |
Official Symbol : | RARRES1 |
Synonyms : | RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1; |
Gene ID : | 5918 |
mRNA Refseq : | NM_002888 |
Protein Refseq : | NP_002879 |
MIM : | 605090 |
Uniprot ID : | P49788 |
Chromosome Location : | 3q25.32 |
Products Types
◆ Recombinant Protein | ||
RARRES1-204H | Recombinant Human RARRES1 protein, His-tagged | +Inquiry |
RARRES1-31293TH | Recombinant Human RARRES1 | +Inquiry |
RARRES1-203H | Recombinant Human retinoic acid receptor responder (tazarotene induced) 1, His-tagged | +Inquiry |
RARRES1-6103C | Recombinant Chicken RARRES1 | +Inquiry |
RARRES1-205H | Recombinant Human RARRES1 protein, His-GST-tagged | +Inquiry |
◆ Lysates | ||
RARRES1-1470HCL | Recombinant Human RARRES1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket