Recombinant Full Length Human RARRES1 Protein

• Cat.No.: RARRES1-432HF
• Product Overview: Recombinant full length Human RARRES1, isoform 1 with N terminal proprietary tag, 50.71 kDa.

Specification

• Description: This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed.
• Source: In Vitro Cell Free System
• Species: Human
• Form: Liquid
• Molecular Mass: 50.710kDa inclusive of tags
• Protein Length: 228 amino acids
• AA Sequence: MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGS GDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSAL RVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYL LYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSS YVMWEMTTQVSHYYLAQLTSVRQWVRKT
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ]
• Official Symbol: RARRES1
• Synonyms: RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1
• Gene ID: 5918
• mRNA Refseq: NM_002888
• Protein Refseq: NP_002879
• MIM: 605090
• UniProt ID: P49788