Recombinant Full Length Human RARRES1 Protein

Cat.No. : RARRES1-432HF
Product Overview : Recombinant full length Human RARRES1, isoform 1 with N terminal proprietary tag, 50.71 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 228 amino acids
Description : This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed.
Form : Liquid
Molecular Mass : 50.710kDa inclusive of tags
AA Sequence : MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGS GDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSAL RVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYL LYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSS YVMWEMTTQVSHYYLAQLTSVRQWVRKT
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ]
Official Symbol RARRES1
Synonyms RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1
Gene ID 5918
mRNA Refseq NM_002888
Protein Refseq NP_002879
MIM 605090
UniProt ID P49788

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RARRES1 Products

Required fields are marked with *

My Review for All RARRES1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon