Recombinant Full Length Human RARRES1 Protein
| Cat.No. : | RARRES1-432HF |
| Product Overview : | Recombinant full length Human RARRES1, isoform 1 with N terminal proprietary tag, 50.71 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 228 amino acids |
| Description : | This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be downregulated in prostate cancer, which is caused by the methylation of its promoter and CpG island. Alternatively spliced transcript variant encoding distinct isoforms have been observed. |
| Form : | Liquid |
| Molecular Mass : | 50.710kDa inclusive of tags |
| AA Sequence : | MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGS GDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSAL RVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYL LYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSS YVMWEMTTQVSHYYLAQLTSVRQWVRKT |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | RARRES1 retinoic acid receptor responder (tazarotene induced) 1 [ Homo sapiens ] |
| Official Symbol | RARRES1 |
| Synonyms | RARRES1; retinoic acid receptor responder (tazarotene induced) 1; retinoic acid receptor responder protein 1; TIG1 |
| Gene ID | 5918 |
| mRNA Refseq | NM_002888 |
| Protein Refseq | NP_002879 |
| MIM | 605090 |
| UniProt ID | P49788 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RARRES1 Products
Required fields are marked with *
My Review for All RARRES1 Products
Required fields are marked with *
