Recombinant Human RARS
| Cat.No. : | RARS-26535TH |
| Product Overview : | Recombinant full length Human Arginyl tRNA synthetase with N-terminal proprietary tag. Predicted MW 98.71kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 660 amino acids |
| Description : | Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Arginyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family. |
| Molecular Weight : | 98.710kDa inclusive of tags |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPN LEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRL QEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMG ISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPG FINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSS PNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGD WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRF DTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQELN KIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDG RKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEK ADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTRVFHAG FGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEK ERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSF DKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAAR ETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEA VAAVMAKGFDILGIKPVQRM |
| Sequence Similarities : | Belongs to the class-I aminoacyl-tRNA synthetase family. |
| Gene Name | RARS arginyl-tRNA synthetase [ Homo sapiens ] |
| Official Symbol | RARS |
| Synonyms | RARS; arginyl-tRNA synthetase; arginyl-tRNA synthetase, cytoplasmic; arginine tRNA ligase 1; cytoplasmic; DALRD1; |
| Gene ID | 5917 |
| mRNA Refseq | NM_002887 |
| Protein Refseq | NP_002878 |
| MIM | 107820 |
| Uniprot ID | P54136 |
| Chromosome Location | 5q35.1 |
| Pathway | Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem; |
| Function | ATP binding; arginine binding; arginine-tRNA ligase activity; ligase activity; nucleotide binding; |
| ◆ Recombinant Proteins | ||
| RARS-13937M | Recombinant Mouse RARS Protein | +Inquiry |
| RARS-3791R | Recombinant Rhesus monkey RARS Protein, His-tagged | +Inquiry |
| RARS-6144H | Recombinant Human RARS Protein (Met1-Pro146), His tagged | +Inquiry |
| RARS-3608R | Recombinant Rhesus Macaque RARS Protein, His (Fc)-Avi-tagged | +Inquiry |
| RARS-2319C | Recombinant Chicken RARS | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RARS-1472HCL | Recombinant Human RARS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RARS Products
Required fields are marked with *
My Review for All RARS Products
Required fields are marked with *
