"RARS" Related Products

Expand
Expand

Recombinant Human RARS

Cat.No. : RARS-26535TH
Product Overview : Recombinant full length Human Arginyl tRNA synthetase with N-terminal proprietary tag. Predicted MW 98.71kDa.
Description : Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Arginyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.
Protein length : 660 amino acids
Molecular Weight : 98.710kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPN LEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRL QEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMG ISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPG FINVHLRKDFVSEQLTSLLVNGVQLPALGENKKVIVDFSS PNIAKEMHVGHLRSTIIGESISRLFEFAGYDVLRLNHVGD WGTQFGMLIAHLQDKFPDYLTVSPPIGDLQVFYKESKKRF DTEEEFKKRAYQCVVLLQGKNPDITKAWKLICDVSRQELN KIYDALDVSLIERGESFYQDRMNDIVKEFEDRGFVQVDDG RKIVFVPGCSIPLTIVKSDGGYTYDTSDLAAIKQRLFEEK ADMIIYVVDNGQSVHFQTIFAAAQMIGWYDPKVTRVFHAG FGVVLGEDKKKFKTRSGETVRLMDLLGEGLKRSMDKLKEK ERDKVLTAEELNAAQTSVAYGCIKYADLSHNRLNDYIFSF DKMLDDRGNTAAYLLYAFTRIRSIARLANIDEEMLQKAAR ETKILLDHEKEWKLGRCILRFPEILQKILDDLFLHTLCDY IYELATAFTEFYDSCYCVEKDRQTGKILKVNMWRMLLCEA VAAVMAKGFDILGIKPVQRM
Sequence Similarities : Belongs to the class-I aminoacyl-tRNA synthetase family.
Gene Name : RARS arginyl-tRNA synthetase [ Homo sapiens ]
Official Symbol : RARS
Synonyms : RARS; arginyl-tRNA synthetase; arginyl-tRNA synthetase, cytoplasmic; arginine tRNA ligase 1; cytoplasmic; DALRD1;
Gene ID : 5917
mRNA Refseq : NM_002887
Protein Refseq : NP_002878
MIM : 107820
Uniprot ID : P54136
Chromosome Location : 5q35.1
Pathway : Aminoacyl-tRNA biosynthesis, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, conserved biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, organism-specific biosystem; Aminoacyl-tRNA biosynthesis, eukaryotes, conserved biosystem; Cytosolic tRNA aminoacylation, organism-specific biosystem;
Function : ATP binding; arginine binding; arginine-tRNA ligase activity; ligase activity; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.