Recombinant Human RARS protein, GST-tagged

• Cat.No.: RARS-301564H
• Product Overview: Recombinant Human RARS (1-190 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Glu190
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: RARS arginyl-tRNA synthetase [ Homo sapiens ]
• Official Symbol: RARS
• Synonyms: RARS; arginyl-tRNA synthetase; arginine--tRNA ligase, cytoplasmic; arginine tRNA ligase 1; cytoplasmic; DALRD1; arginine tRNA ligase 1, cytoplasmic; arginyl-tRNA synthetase, cytoplasmic; ArgRS; MGC8641
• Gene ID: 5917
• mRNA Refseq: NM_002887
• Protein Refseq: NP_002878
• MIM: 107820
• UniProt ID: P54136