Recombinant Human RARS protein, GST-tagged
| Cat.No. : | RARS-301564H |
| Product Overview : | Recombinant Human RARS (1-190 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Glu190 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MDVLVSECSARLLQQEEEIKSLTAEIDRLKNCGCLGASPNLEQLQEENLKLKYRLNILRKSLQAERNKPTKNMINIISRLQEVFGHAIKAAYPDLENPPLLVTPSQQAKFGDYQCNSAMGISQMLKTKEQKVNPREIAENITKHLPDNECIEKVEIAGPGFINVHLRKDFVSEQLTSLLVNGVQLPALGE |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | RARS arginyl-tRNA synthetase [ Homo sapiens ] |
| Official Symbol | RARS |
| Synonyms | RARS; arginyl-tRNA synthetase; arginine--tRNA ligase, cytoplasmic; arginine tRNA ligase 1; cytoplasmic; DALRD1; arginine tRNA ligase 1, cytoplasmic; arginyl-tRNA synthetase, cytoplasmic; ArgRS; MGC8641; |
| Gene ID | 5917 |
| mRNA Refseq | NM_002887 |
| Protein Refseq | NP_002878 |
| MIM | 107820 |
| UniProt ID | P54136 |
| ◆ Recombinant Proteins | ||
| RARS-7427M | Recombinant Mouse RARS Protein, His (Fc)-Avi-tagged | +Inquiry |
| RARS-301564H | Recombinant Human RARS protein, GST-tagged | +Inquiry |
| RARS-6144H | Recombinant Human RARS Protein (Met1-Pro146), His tagged | +Inquiry |
| RARS-3608R | Recombinant Rhesus Macaque RARS Protein, His (Fc)-Avi-tagged | +Inquiry |
| RARS-13937M | Recombinant Mouse RARS Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RARS-1472HCL | Recombinant Human RARS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RARS Products
Required fields are marked with *
My Review for All RARS Products
Required fields are marked with *
