"RBBP5" Related Products

Expand

Recombinant Human RBBP5, His-tagged

Cat.No.: RBBP5-28182TH
Product Overview: Recombinant fragment, corresponding to amino acids 359-538 of Human RbBP5 with an N terminal His tag. Predicted mwt: 20 kDa;
Description: This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. The encoded protein binds directly to retinoblastoma protein, which regulates cell proliferation. It interacts preferentially with the underphosphorylated retinoblastoma protein via the E1A-binding pocket B. Three alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Conjugation: HIS
Source: E. coli
Tissue specificity: Ubiquitously expressed.
Form: Lyophilised:Reconstitute with 148 μl distilled water.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKA LLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEK KRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVK GDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEG SAKGKVQAELSQPLTAGGAISELL
Sequence Similarities: Contains 6 WD repeats.
Gene Name: RBBP5 retinoblastoma binding protein 5 [ Homo sapiens ]
Official Symbol: RBBP5
Synonyms: RBBP5; retinoblastoma binding protein 5; retinoblastoma-binding protein 5; RBQ3; SWD1; Set1c WD40 repeat protein; homolog (S. cerevisiae);
Gene ID: 5929
mRNA Refseq: NM_001193272
Protein Refseq: NP_001180201
MIM: 600697
Uniprot ID: Q15291
Chromosome Location: 1q32
Function: contributes_to histone methyltransferase activity (H3-K4 specific); methylated histone residue binding; protein binding; transcription regulatory region DNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.