Recombinant Human RBBP5, His-tagged
Cat.No. : | RBBP5-28182TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 359-538 of Human RbBP5 with an N terminal His tag. Predicted mwt: 20 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 359-538 a.a. |
Description : | This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. The encoded protein binds directly to retinoblastoma protein, which regulates cell proliferation. It interacts preferentially with the underphosphorylated retinoblastoma protein via the E1A-binding pocket B. Three alternatively spliced transcript variants that encode different protein isoforms have been described for this gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitously expressed. |
Form : | Lyophilised:Reconstitute with 148 μl distilled water. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKA LLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEK KRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVK GDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEG SAKGKVQAELSQPLTAGGAISELL |
Sequence Similarities : | Contains 6 WD repeats. |
Gene Name | RBBP5 retinoblastoma binding protein 5 [ Homo sapiens ] |
Official Symbol | RBBP5 |
Synonyms | RBBP5; retinoblastoma binding protein 5; retinoblastoma-binding protein 5; RBQ3; SWD1; Set1c WD40 repeat protein; homolog (S. cerevisiae); |
Gene ID | 5929 |
mRNA Refseq | NM_001193272 |
Protein Refseq | NP_001180201 |
MIM | 600697 |
Uniprot ID | Q15291 |
Chromosome Location | 1q32 |
Function | contributes_to histone methyltransferase activity (H3-K4 specific); methylated histone residue binding; protein binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
RBBP5-7458M | Recombinant Mouse RBBP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBBP5-082H | Active Recombinant Human RBBP5 Protein | +Inquiry |
RBBP5-2199H | Recombinant Human RBBP5, GST-tagged | +Inquiry |
RBBP5-025H | Active Recombinant Human RBBP5 Protein, SUMO-tagged | +Inquiry |
RBBP5-10585Z | Recombinant Zebrafish RBBP5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBBP5-1479HCL | Recombinant Human RBBP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBBP5 Products
Required fields are marked with *
My Review for All RBBP5 Products
Required fields are marked with *