Recombinant Human RBBP5, His-tagged

Cat.No. : RBBP5-28182TH
Product Overview : Recombinant fragment, corresponding to amino acids 359-538 of Human RbBP5 with an N terminal His tag. Predicted mwt: 20 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 359-538 a.a.
Description : This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. The encoded protein binds directly to retinoblastoma protein, which regulates cell proliferation. It interacts preferentially with the underphosphorylated retinoblastoma protein via the E1A-binding pocket B. Three alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Conjugation : HIS
Tissue specificity : Ubiquitously expressed.
Form : Lyophilised:Reconstitute with 148 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KSEPEQTGADAAEDEEVDVTSVDPIAAFCSSDEELEDSKA LLYLPIAPEVEDPEENPYGPPPDAVQTSLMDEGASSEK KRQSSADGSQPPKKKPKTTNIELQGVPNDEVHPLLGVK GDGKSKKKQAGRPKGSKGKEKDSPFKPKLYKGDRGLPLEG SAKGKVQAELSQPLTAGGAISELL
Sequence Similarities : Contains 6 WD repeats.
Gene Name RBBP5 retinoblastoma binding protein 5 [ Homo sapiens ]
Official Symbol RBBP5
Synonyms RBBP5; retinoblastoma binding protein 5; retinoblastoma-binding protein 5; RBQ3; SWD1; Set1c WD40 repeat protein; homolog (S. cerevisiae);
Gene ID 5929
mRNA Refseq NM_001193272
Protein Refseq NP_001180201
MIM 600697
Uniprot ID Q15291
Chromosome Location 1q32
Function contributes_to histone methyltransferase activity (H3-K4 specific); methylated histone residue binding; protein binding; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBBP5 Products

Required fields are marked with *

My Review for All RBBP5 Products

Required fields are marked with *

0
cart-icon