"RBBP9" Related Products

Expand
Expand

Recombinant Human RBBP9, His-tagged

Cat.No.: RBBP9-26383TH
Product Overview: Recombinant full length Human RBBP9 with an N terminal His tag; 206 amino acids with a predicted MWt of 23.1 kDa including the tag.
Description: The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate.
Protein length: 186 amino acids
Conjugation: HIS
Molecular Weight: 23.100kDa inclusive of tags
Source: E. coli
Tissue specificity: Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMASPSKAVIVPGNGGGDVTT HGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFME TELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYT SDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS LLKVPA
Sequence Similarities: Belongs to the RBBP9 family.
Gene Name: RBBP9 retinoblastoma binding protein 9 [ Homo sapiens ]
Official Symbol: RBBP9
Synonyms: RBBP9; retinoblastoma binding protein 9; putative hydrolase RBBP9; Bog;
Gene ID: 10741
mRNA Refseq: NM_006606
Protein Refseq: NP_006597
MIM: 602908
Uniprot ID: O75884
Chromosome Location: 20p11.2
Function: hydrolase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.