Recombinant Human RBBP9, His-tagged
| Cat.No. : | RBBP9-26383TH |
| Product Overview : | Recombinant full length Human RBBP9 with an N terminal His tag; 206 amino acids with a predicted MWt of 23.1 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 186 amino acids |
| Description : | The protein encoded by this gene is a retinoblastoma binding protein that may play a role in the regulation of cell proliferation and differentiation. Two alternatively spliced transcript variants of this gene with identical predicted protein products have been reported, one of which is a nonsense-mediated decay candidate. |
| Conjugation : | HIS |
| Molecular Weight : | 23.100kDa inclusive of tags |
| Tissue specificity : | Widely expressed. Expressed at higher levels in tumor tissues than in normal tissues. |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride |
| Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMASPSKAVIVPGNGGGDVTT HGWYGWVKKELEKIPGFQCLAKNMPDPITARESIWLPFME TELHCDEKTIIIGHSSGAIAAMRYAETHRVYAIVLVSAYT SDLGDENERASGYFTRPWQWEKIKANCPYIVQFGSTDDPF LPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKS LLKVPA |
| Sequence Similarities : | Belongs to the RBBP9 family. |
| Gene Name | RBBP9 retinoblastoma binding protein 9 [ Homo sapiens ] |
| Official Symbol | RBBP9 |
| Synonyms | RBBP9; retinoblastoma binding protein 9; putative hydrolase RBBP9; Bog; |
| Gene ID | 10741 |
| mRNA Refseq | NM_006606 |
| Protein Refseq | NP_006597 |
| MIM | 602908 |
| Uniprot ID | O75884 |
| Chromosome Location | 20p11.2 |
| Function | hydrolase activity; |
| ◆ Recombinant Proteins | ||
| Rbbp9-5644M | Recombinant Mouse Rbbp9 protein, His-tagged | +Inquiry |
| RBBP9-3837Z | Recombinant Zebrafish RBBP9 | +Inquiry |
| RBBP9-3806R | Recombinant Rhesus monkey RBBP9 Protein, His-tagged | +Inquiry |
| RBBP9-4952R | Recombinant Rat RBBP9 Protein | +Inquiry |
| RBBP9-1543H | Recombinant Human Retinoblastoma Binding Protein 9, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBBP9-2488HCL | Recombinant Human RBBP9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBBP9 Products
Required fields are marked with *
My Review for All RBBP9 Products
Required fields are marked with *
