Recombinant Human RBM3
Cat.No. : | RBM3-31231TH |
Product Overview : | Recombinant fragment of Human RBM3 protein with an N terminal proprietary tag. Predicted MWt 34.43 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 80 amino acids |
Description : | This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. |
Molecular Weight : | 34.430kDa |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD |
Sequence Similarities : | Contains 1 RRM (RNA recognition motif) domain. |
Gene Name | RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ] |
Official Symbol | RBM3 |
Synonyms | RBM3; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; putative RNA-binding protein 3; IS1 RNPL; |
Gene ID | 5935 |
mRNA Refseq | NM_006743 |
Protein Refseq | NP_006734 |
MIM | 300027 |
Uniprot ID | P98179 |
Chromosome Location | Xp11.2 |
Function | RNA binding; nucleotide binding; ribosomal large subunit binding; |
◆ Recombinant Proteins | ||
RBM3-1500H | Recombinant Human RBM3 Protein (1-157 aa), His-tagged | +Inquiry |
RBM3-3634R | Recombinant Rhesus Macaque RBM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBM3-3413H | Recombinant Human RBM3 protein, His-SUMO-tagged | +Inquiry |
RBM3-582H | Recombinant Human RNA binding motif (RNP1, RRM) protein 3, His-tagged | +Inquiry |
RBM3-3817R | Recombinant Rhesus monkey RBM3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBM3-2474HCL | Recombinant Human RBM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM3 Products
Required fields are marked with *
My Review for All RBM3 Products
Required fields are marked with *