"RBM3" Related Products

Expand

Recombinant Human RBM3

Cat.No.: RBM3-31231TH
Product Overview: Recombinant fragment of Human RBM3 protein with an N terminal proprietary tag. Predicted MWt 34.43 kDa.
Description: This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria.
Protein length: 80 amino acids
Molecular Weight: 34.430kDa
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVD
Sequence Similarities: Contains 1 RRM (RNA recognition motif) domain.
Gene Name: RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ]
Official Symbol: RBM3
Synonyms: RBM3; RNA binding motif (RNP1, RRM) protein 3; RNA binding motif protein 3; putative RNA-binding protein 3; IS1 RNPL;
Gene ID: 5935
mRNA Refseq: NM_006743
Protein Refseq: NP_006734
MIM: 300027
Uniprot ID: P98179
Chromosome Location: Xp11.2
Function: RNA binding; nucleotide binding; ribosomal large subunit binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.