Recombinant Human RBM3 Protein (1-157 aa), His-tagged
| Cat.No. : | RBM3-1500H |
| Product Overview : | Recombinant Human RBM3 Protein (1-157 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-157 aa |
| Description : | Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic tperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 19.2 kDa |
| AA Sequence : | MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ] |
| Official Symbol | RBM3 |
| Synonyms | RBM3; IS1 RNPL; RNPL; IS1-RNPL; |
| Gene ID | 5935 |
| mRNA Refseq | NM_006743 |
| Protein Refseq | NP_006734 |
| MIM | 300027 |
| UniProt ID | P98179 |
| ◆ Recombinant Proteins | ||
| RBM3-1500H | Recombinant Human RBM3 Protein (1-157 aa), His-tagged | +Inquiry |
| RBM3-31231TH | Recombinant Human RBM3 | +Inquiry |
| RBM3-2214H | Recombinant Human RBM3, GST-tagged | +Inquiry |
| RBM3-545H | Recombinant Human RBM3 Protein, His-tagged | +Inquiry |
| RBM3-3634R | Recombinant Rhesus Macaque RBM3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RBM3-2474HCL | Recombinant Human RBM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RBM3 Products
Required fields are marked with *
My Review for All RBM3 Products
Required fields are marked with *



