Recombinant Human RBM3 Protein (1-157 aa), His-tagged

Cat.No. : RBM3-1500H
Product Overview : Recombinant Human RBM3 Protein (1-157 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 1-157 aa
Description : Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic tperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.2 kDa
AA Sequence : MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name RBM3 RNA binding motif (RNP1, RRM) protein 3 [ Homo sapiens ]
Official Symbol RBM3
Synonyms RBM3; IS1 RNPL; RNPL; IS1-RNPL;
Gene ID 5935
mRNA Refseq NM_006743
Protein Refseq NP_006734
MIM 300027
UniProt ID P98179

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RBM3 Products

Required fields are marked with *

My Review for All RBM3 Products

Required fields are marked with *

0
cart-icon