"RDH13" Related Products

Recombinant Human RDH13, His-tagged

Cat.No.: RDH13-31309TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-260 of Human RDH13 (Isoform 2) with N terminal His tag, 37kDa.
Description: This gene encodes a mitochondrial short-chain dehydrogenase/reductase, which catalyzes the reduction and oxidation of retinoids. The encoded enzyme may function in retinoic acid production and may also protect the mitochondria against oxidative stress. Alternatively spliced transcript variants have been described.
Conjugation: HIS
Source: E. coli
Tissue specificity: Expressed mostly in eye, pancreas, placenta and lung. In the retina, detected in the inner segment of the photoreceptor cells. Weak signals were observed in a small population of inner nuclear neurons and the inner plexiform layer.
Form: Lyophilised:Reconstitute with 140 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKI IEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLG HFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDL NWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNA LHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPE LAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDE EVARRLWAESARLVGLEAPSVREQPLPR
Sequence Similarities: Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name: RDH13 retinol dehydrogenase 13 (all-trans/9-cis) [ Homo sapiens ]
Official Symbol: RDH13
Synonyms: RDH13; retinol dehydrogenase 13 (all-trans/9-cis); retinol dehydrogenase 13 (all trans and 9 cis); retinol dehydrogenase 13; SDR7C3; short chain dehydrogenase/reductase family 7C; member 3;
Gene ID: 112724
mRNA Refseq: NM_138412
Protein Refseq: NP_612421
Uniprot ID: Q8NBN7
Chromosome Location: 19q13.42
Function: nucleotide binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.