Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at BIO-Europe Spring|March 18–20, 2024|Booth #34

Recombinant Human RDH13, His-tagged

Cat.No. : RDH13-31309TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-260 of Human RDH13 (Isoform 2) with N terminal His tag, 37kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a mitochondrial short-chain dehydrogenase/reductase, which catalyzes the reduction and oxidation of retinoids. The encoded enzyme may function in retinoic acid production and may also protect the mitochondria against oxidative stress. Alternatively spliced transcript variants have been described.
Conjugation : HIS
Source : E. coli
Tissue specificity : Expressed mostly in eye, pancreas, placenta and lung. In the retina, detected in the inner segment of the photoreceptor cells. Weak signals were observed in a small population of inner nuclear neurons and the inner plexiform layer.
Form : Lyophilised:Reconstitute with 140 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKI IEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLG HFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDL NWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNA LHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPE LAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDE EVARRLWAESARLVGLEAPSVREQPLPR
Sequence Similarities : Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Gene Name : RDH13 retinol dehydrogenase 13 (all-trans/9-cis) [ Homo sapiens ]
Official Symbol : RDH13
Synonyms : RDH13; retinol dehydrogenase 13 (all-trans/9-cis); retinol dehydrogenase 13 (all trans and 9 cis); retinol dehydrogenase 13; SDR7C3; short chain dehydrogenase/reductase family 7C; member 3;
Gene ID : 112724
mRNA Refseq : NM_138412
Protein Refseq : NP_612421
Uniprot ID : Q8NBN7
Chromosome Location : 19q13.42
Function : nucleotide binding; oxidoreductase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RDH13 Products

Required fields are marked with *

My Review for All RDH13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends