Recombinant Human RDH13, His-tagged
Cat.No. : | RDH13-31309TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-260 of Human RDH13 (Isoform 2) with N terminal His tag, 37kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-260 a.a. |
Description : | This gene encodes a mitochondrial short-chain dehydrogenase/reductase, which catalyzes the reduction and oxidation of retinoids. The encoded enzyme may function in retinoic acid production and may also protect the mitochondria against oxidative stress. Alternatively spliced transcript variants have been described. |
Conjugation : | HIS |
Tissue specificity : | Expressed mostly in eye, pancreas, placenta and lung. In the retina, detected in the inner segment of the photoreceptor cells. Weak signals were observed in a small population of inner nuclear neurons and the inner plexiform layer. |
Form : | Lyophilised:Reconstitute with 140 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEKCEAAAKDIRGETLNHHVNARHLDLASLKSIREFAAKI IEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLG HFLLTNLLLDKLKASAPSRIINLSSLAHVAGHIDFDDL NWQTRKYNTKAAYCQSKLAIVLFTKELSRRLQGSGVTVNA LHPGVARTELGRHTGIHGSTFSSTTLGPIFWLLVKSPE LAAQPSTYLAVAEELADVSGKYFDGLKQKAPAPEAEDE EVARRLWAESARLVGLEAPSVREQPLPR |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Full Length : | Full L. |
Gene Name | RDH13 retinol dehydrogenase 13 (all-trans/9-cis) [ Homo sapiens ] |
Official Symbol | RDH13 |
Synonyms | RDH13; retinol dehydrogenase 13 (all-trans/9-cis); retinol dehydrogenase 13 (all trans and 9 cis); retinol dehydrogenase 13; SDR7C3; short chain dehydrogenase/reductase family 7C; member 3; |
Gene ID | 112724 |
mRNA Refseq | NM_138412 |
Protein Refseq | NP_612421 |
Uniprot ID | Q8NBN7 |
Chromosome Location | 19q13.42 |
Function | nucleotide binding; oxidoreductase activity; |
◆ Recombinant Proteins | ||
Rdh13-389M | Recombinant Mouse Rdh13 Protein, MYC/DDK-tagged | +Inquiry |
RDH13-7509M | Recombinant Mouse RDH13 Protein, His (Fc)-Avi-tagged | +Inquiry |
RDH13-14048M | Recombinant Mouse RDH13 Protein | +Inquiry |
RDH13-2238H | Recombinant Human RDH13, His-tagged | +Inquiry |
RDH13-31309TH | Recombinant Human RDH13, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RDH13-1488HCL | Recombinant Human RDH13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RDH13 Products
Required fields are marked with *
My Review for All RDH13 Products
Required fields are marked with *