"RYK" Related Products

Expand
Expand

Recombinant Human RYK

Cat.No.: RYK-31340TH
Product Overview: Recombinant fragment of Human RYK with N terminal proprietary tag, 37.73kDa.
Description: The protein encoded by this gene is an atypical member of the family of growth factor receptor protein tyrosine kinases, differing from other members at a number of conserved residues in the activation and nucleotide binding domains. This gene product belongs to a subfamily whose members do not appear to be regulated by phosphorylation in the activation segment. It has been suggested that mediation of biological activity by recruitment of a signaling-competent auxiliary protein may occur through an as yet uncharacterized mechanism. Two alternative splice variants have been identified, encoding distinct isoforms.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Observed in all the tissues examined.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ELQSASAGPSVSLYLSEDEVRRLIGLDAELYYVRNDLISH YALSFSLLVPSETNFLHFTWHAKSKVEYKLGFQVDNVLAM DMPQVNISVQGEVPRTLSVFRVELSCTGKV
Sequence Similarities: Belongs to the protein kinase superfamily. Tyr protein kinase family.Contains 1 protein kinase domain.Contains 1 WIF domain.
Gene Name: RYK RYK receptor-like tyrosine kinase [ Homo sapiens ]
Official Symbol: RYK
Synonyms: RYK; RYK receptor-like tyrosine kinase; JTK5A, JTK5A protein tyrosine kinase; tyrosine-protein kinase RYK; D3S3195; JTK5; RYK1;
Gene ID: 6259
mRNA Refseq: NM_002958
Protein Refseq: NP_002949
MIM: 600524
Uniprot ID: P34925
Chromosome Location: 3q22.1
Pathway: Wnt signaling network, organism-specific biosystem;
Function: ATP binding; Wnt-protein binding; frizzled binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.