"SEPT1" Related Products

Recombinant Human SEPT1, HIS-tagged

Cat.No.: SEPT1-30600TH
Product Overview: Recombinant fragment, corresponding to amino acids 1-174 of Human SEPT1 with N terminal His tag. MWt ~20kDa;
Description: This gene is a member of the septin family of GTPases. Members of this family are required for cytokinesis and the maintenance of cellular morphology. This gene encodes a protein that can form homo- and heterooligomeric filaments, and may contribute to the formation of neurofibrillary tangles in Alzheimers disease.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 119 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: (Amino acid sequence (Sequence determined by 5 Sequencing))MDKEYVGFAALPNQLHRKSVKKGFDF TLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLT QTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWL PVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFIS PFGRGLRPLDVAFLRAVHEKVNIIPVIGKADA
Gene Name: SEPT1 septin 1 [ Homo sapiens ]
Official Symbol: SEPT1
Synonyms: SEPT1; septin 1; DIFF6; septin-1; PNUTL3;
Gene ID: 1731
mRNA Refseq: NM_052838
Protein Refseq: NP_443070
MIM: 612897
Uniprot ID: Q8WYJ6
Chromosome Location: 16p11.1
Pathway: Aurora B signaling, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem;
Function: GTP binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.