Recombinant Human SLC7A1

Cat.No. : SLC7A1-26816TH
Product Overview : Recombinant fragment of Human CAT1 with an N terminal proprietary tag. Predicted MW 32.45kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 62 amino acids
Description : High affinity cationic amino acid transporter 1 is a protein that in humans is encoded by the SLC7A1 gene.
Molecular Weight : 32.450kDa inclusive of tags
Tissue specificity : Ubiquitous.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
Sequence Similarities : Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
Gene Name SLC7A1 solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [ Homo sapiens ]
Official Symbol SLC7A1
Synonyms SLC7A1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; ATRC1, ERR; high affinity cationic amino acid transporter 1; amino acid transporter; cationic 1; CAT 1; ecotropic retroviral receptor; HCAT1; REC1L;
Gene ID 6541
mRNA Refseq NM_003045
Protein Refseq NP_003036
MIM 104615
Uniprot ID P30825
Chromosome Location 13q12-q14
Pathway Amino acid transport across the plasma membrane, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function amino acid transmembrane transporter activity; arginine transmembrane transporter activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC7A1 Products

Required fields are marked with *

My Review for All SLC7A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon