"SLC7A1" Related Products

Expand
Expand

Recombinant Human SLC7A1

Cat.No.: SLC7A1-26816TH
Product Overview: Recombinant fragment of Human CAT1 with an N terminal proprietary tag. Predicted MW 32.45kDa.
Description: High affinity cationic amino acid transporter 1 is a protein that in humans is encoded by the SLC7A1 gene.
Protein length: 62 amino acids
Molecular Weight: 32.450kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS
Sequence Similarities: Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family.
Gene Name: SLC7A1 solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [ Homo sapiens ]
Official Symbol: SLC7A1
Synonyms: SLC7A1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; ATRC1, ERR; high affinity cationic amino acid transporter 1; amino acid transporter; cationic 1; CAT 1; ecotropic retroviral receptor; HCAT1; REC1L;
Gene ID: 6541
mRNA Refseq: NM_003045
Protein Refseq: NP_003036
MIM: 104615
Uniprot ID: P30825
Chromosome Location: 13q12-q14
Pathway: Amino acid transport across the plasma membrane, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem;
Function: amino acid transmembrane transporter activity; arginine transmembrane transporter activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.