Recombinant Human SLC7A1
Cat.No. : | SLC7A1-26816TH |
Product Overview : | Recombinant fragment of Human CAT1 with an N terminal proprietary tag. Predicted MW 32.45kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 62 amino acids |
Description : | High affinity cationic amino acid transporter 1 is a protein that in humans is encoded by the SLC7A1 gene. |
Molecular Weight : | 32.450kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RYQPEQPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKIS |
Sequence Similarities : | Belongs to the amino acid-polyamine-organocation (APC) superfamily. Cationic amino acid transporter (CAT) (TC 2.A.3.3) family. |
Gene Name | SLC7A1 solute carrier family 7 (cationic amino acid transporter, y+ system), member 1 [ Homo sapiens ] |
Official Symbol | SLC7A1 |
Synonyms | SLC7A1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; ATRC1, ERR; high affinity cationic amino acid transporter 1; amino acid transporter; cationic 1; CAT 1; ecotropic retroviral receptor; HCAT1; REC1L; |
Gene ID | 6541 |
mRNA Refseq | NM_003045 |
Protein Refseq | NP_003036 |
MIM | 104615 |
Uniprot ID | P30825 |
Chromosome Location | 13q12-q14 |
Pathway | Amino acid transport across the plasma membrane, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Transport of inorganic cations/anions and amino acids/oligopeptides, organism-specific biosystem; |
Function | amino acid transmembrane transporter activity; arginine transmembrane transporter activity; receptor activity; |
◆ Recombinant Proteins | ||
SLC7A1-26816TH | Recombinant Human SLC7A1 | +Inquiry |
SLC7A1-4126R | Recombinant Rhesus Macaque SLC7A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC7A1-2322H | Recombinant Human CLDN18 Full Length Transmembrane protein(VLPs), FITC labeled | +Inquiry |
Slc7a1-679M | Recombinant Mouse Slc7a1 Protein, MYC/DDK-tagged | +Inquiry |
SLC7A1-5573R | Recombinant Rat SLC7A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC7A1-1700HCL | Recombinant Human SLC7A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC7A1 Products
Required fields are marked with *
My Review for All SLC7A1 Products
Required fields are marked with *