Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SPA17

Cat.No. : SPA17-31433TH
Product Overview : Recombinant full length Human SP17 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-151; 151 amino acids, 17.4kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Sequences of amino acids : MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAA AYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQE PPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEV AAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Gene Name : SPA17 sperm autoantigenic protein 17 [ Homo sapiens ]
Official Symbol : SPA17
Synonyms : SPA17; sperm autoantigenic protein 17; sperm surface protein Sp17; cancer/testis antigen 22; CT22; SP17;
Gene ID : 53340
mRNA Refseq : NM_017425
Protein Refseq : NP_059121
MIM : 608621
Uniprot ID : Q15506
Chromosome Location : 11q24.2
Function : cAMP-dependent protein kinase regulator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All SPA17 Products

Required fields are marked with *

My Review for All SPA17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends