Recombinant Human SPA17
Cat.No. : | SPA17-31433TH |
Product Overview : | Recombinant full length Human SP17 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-151; 151 amino acids, 17.4kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAA AYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQE PPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEV AAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK |
Gene Name : | SPA17 sperm autoantigenic protein 17 [ Homo sapiens ] |
Official Symbol : | SPA17 |
Synonyms : | SPA17; sperm autoantigenic protein 17; sperm surface protein Sp17; cancer/testis antigen 22; CT22; SP17; |
Gene ID : | 53340 |
mRNA Refseq : | NM_017425 |
Protein Refseq : | NP_059121 |
MIM : | 608621 |
Uniprot ID : | Q15506 |
Chromosome Location : | 11q24.2 |
Function : | cAMP-dependent protein kinase regulator activity; |
Products Types
◆ Recombinant Protein | ||
SPA17-703C | Recombinant Cynomolgus Monkey SPA17 Protein, His (Fc)-Avi-tagged | +Inquiry |
SPA17-4236R | Recombinant Rhesus Macaque SPA17 Protein, His (Fc)-Avi-tagged | +Inquiry |
Spa17-2001M | Recombinant Mouse Spa17 protein, His & T7-tagged | +Inquiry |
SPA17-4888Z | Recombinant Zebrafish SPA17 | +Inquiry |
SPA17-2890H | Recombinant Human SPA17, GST-tagged | +Inquiry |
◆ Lysates | ||
SPA17-1552HCL | Recombinant Human SPA17 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SPA17 Products
Required fields are marked with *
My Review for All SPA17 Products
Required fields are marked with *
0
Inquiry Basket