Recombinant Full Length Human SPA17 Protein
| Cat.No. : | SPA17-31433TH |
| Product Overview : | Recombinant full length Human SP17 with 25 kDa proprietary tag produced in Saccharomyces cerevisiae; amino acids 1-151; 151 amino acids, 17.4kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | S.Cerevisiae |
| Tag : | Non |
| Protein Length : | 1-151 a.a. |
| Description : | This gene encodes a protein present at the cell surface. The N-terminus has sequence similarity to human cAMP-dependent protein kinase A (PKA) type II alpha regulatory subunit (RIIa) while the C-terminus has an IQ calmodulin-binding motif. The central portion of the protein has carbohydrate binding motifs and likely functions in cell-cell adhesion. The protein was initially characterized by its involvement in the binding of sperm to the zona pellucida of the oocyte. Recent studies indicate that it is also involved in additional cell-cell adhesion functions such as immune cell migration and metastasis. A retrotransposed pseudogene is present on chromosome 10q22. |
| Form : | Liquid |
| Purity : | >90% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAA AYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQE PPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEV AAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK |
| Full Length : | Full L. |
| Gene Name | SPA17 sperm autoantigenic protein 17 [ Homo sapiens ] |
| Official Symbol | SPA17 |
| Synonyms | SPA17; sperm autoantigenic protein 17; sperm surface protein Sp17; cancer/testis antigen 22; CT22; SP17; |
| Gene ID | 53340 |
| mRNA Refseq | NM_017425 |
| Protein Refseq | NP_059121 |
| MIM | 608621 |
| Uniprot ID | Q15506 |
| Chromosome Location | 11q24.2 |
| Function | cAMP-dependent protein kinase regulator activity; |
| ◆ Recombinant Proteins | ||
| SPA17-2890H | Recombinant Full Length Human SPA17, GST-tagged | +Inquiry |
| SPA17-31433TH | Recombinant Full Length Human SPA17 Protein | +Inquiry |
| Spa17-1383M | Recombinant Mouse Spa17 protein, His-tagged | +Inquiry |
| SPA17-960C | Recombinant Cynomolgus SPA17 Protein, His-tagged | +Inquiry |
| SPA17-530H | Recombinant Full Length Human sperm autoantigenic protein 17, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SPA17-1552HCL | Recombinant Human SPA17 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPA17 Products
Required fields are marked with *
My Review for All SPA17 Products
Required fields are marked with *
