"SPTLC1" Related Products

Recombinant Human SPTLC1, His-tagged

Cat.No.: SPTLC1-30887TH
Product Overview: Recombinant fragment, corresponding to amino acids 221-473 of Human SPTLC1 with N terminal His tag; MWt 33 kDa ,
Description: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified.
Conjugation: HIS
Source: E. coli
Tissue specificity: Widely expressed. Not detected in small intestine.
Form: Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPEL VKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINID DIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYC FSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIH KALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQE IVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVEQ TEEELERAASTIKEVAQAVLL
Sequence Similarities: Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Gene Name: SPTLC1 serine palmitoyltransferase, long chain base subunit 1 [ Homo sapiens ]
Official Symbol: SPTLC1
Synonyms: SPTLC1; serine palmitoyltransferase, long chain base subunit 1; hereditary sensory neuropathy, type 1 , HSN1; serine palmitoyltransferase 1; hLCB1; HSAN1; LCB1; SPTI;
Gene ID: 10558
mRNA Refseq: NM_178324
Protein Refseq: NP_847894
MIM: 605712
Uniprot ID: O15269
Chromosome Location: 9q22.31
Pathway: Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem;
Function: protein binding; pyridoxal phosphate binding; serine C-palmitoyltransferase activity; transferase activity; transferase activity, transferring acyl groups;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.