Recombinant Human SPTLC1, His-tagged

Cat.No. : SPTLC1-30887TH
Product Overview : Recombinant fragment, corresponding to amino acids 221-473 of Human SPTLC1 with N terminal His tag; MWt 33 kDa ,
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 221-473 a.a.
Description : Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5-phosphate as a cofactor. The product of this gene is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified.
Conjugation : HIS
Tissue specificity : Widely expressed. Not detected in small intestine.
Form : Lyophilised:Reconstitute with 148 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPEL VKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINID DIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYC FSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIH KALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQE IVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVEQ TEEELERAASTIKEVAQAVLL
Sequence Similarities : Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family.
Gene Name SPTLC1 serine palmitoyltransferase, long chain base subunit 1 [ Homo sapiens ]
Official Symbol SPTLC1
Synonyms SPTLC1; serine palmitoyltransferase, long chain base subunit 1; hereditary sensory neuropathy, type 1 , HSN1; serine palmitoyltransferase 1; hLCB1; HSAN1; LCB1; SPTI;
Gene ID 10558
mRNA Refseq NM_178324
Protein Refseq NP_847894
MIM 605712
Uniprot ID O15269
Chromosome Location 9q22.31
Pathway Metabolic pathways, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem;
Function protein binding; pyridoxal phosphate binding; serine C-palmitoyltransferase activity; transferase activity; transferase activity, transferring acyl groups;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPTLC1 Products

Required fields are marked with *

My Review for All SPTLC1 Products

Required fields are marked with *

0
cart-icon
0
compare icon