Recombinant Full Length Pongo Abelii Serine Palmitoyltransferase 1(Sptlc1) Protein, His-Tagged
Cat.No. : | RFL13194PF |
Product Overview : | Recombinant Full Length Pongo abelii Serine palmitoyltransferase 1(SPTLC1) Protein (Q5R9T5) (1-473aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pongo Abelii |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-473) |
Form : | Lyophilized powder |
AA Sequence : | MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEEL IEEWQPEPLVPLVPKDHPALNYNIVSGPPSHKIVVNGKECINFASFNFLGLLDNPRVKAA ALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSK RGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRR FIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDI DLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENP GIFAVLKEKCRQIHKALQGISGLKVVGEPLSPAFHLQLEESTGSREQDVRLLQEIVDQCM NRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELDRAASTIKEVAQAVLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SPTLC1 |
Synonyms | SPTLC1; Serine palmitoyltransferase 1; Long chain base biosynthesis protein 1; LCB 1; Serine-palmitoyl-CoA transferase 1; SPT 1; SPT1 |
UniProt ID | Q5R9T5 |
◆ Recombinant Proteins | ||
SPTLC1-2092H | Recombinant Human SPTLC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Sptlc1-6117M | Recombinant Mouse Sptlc1 Protein, Myc/DDK-tagged | +Inquiry |
SPTLC1-2676Z | Recombinant Zebrafish SPTLC1 | +Inquiry |
RFL6256MF | Recombinant Full Length Mouse Serine Palmitoyltransferase 1(Sptlc1) Protein, His-Tagged | +Inquiry |
SPTLC1-30887TH | Recombinant Human SPTLC1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPTLC1-1485HCL | Recombinant Human SPTLC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPTLC1 Products
Required fields are marked with *
My Review for All SPTLC1 Products
Required fields are marked with *
0
Inquiry Basket