Recombinant Human SRF

• Cat.No.: SRF-30614TH
• Product Overview: Recombinant fragment corresponding to amino acids 406-508 of Human Serum Response Factor SRF with an N terminal proprietary tag; Predicted MWt 36.96 kDa.

Specification

• Description: This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response element (SRE) in the promoter region of target genes. This protein regulates the activity of many immediate-early genes, for example c-fos, and thereby participates in cell cycle regulation, apoptosis, cell growth, and cell differentiation. This gene is the downstream target of many pathways; for example, the mitogen-activated protein kinase pathway (MAPK) that acts through the ternary complex factors (TCFs).
• Protein length: 103 amino acids
• Molecular Weight: 36.960kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: HMMYPSPHAVMYAPTSGLGDGSLTVLNAFSQAPSTMQVSH SQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAVIGQQA GSSSNLTELQVVNLDTAHSTKSE
• Sequence Similarities: Contains 1 MADS-box domain.

Gene Information

• Gene Name: SRF serum response factor (c-fos serum response element-binding transcription factor) [ Homo sapiens ]
• Official Symbol: SRF
• Synonyms: SRF; serum response factor (c-fos serum response element-binding transcription factor); serum response factor; MCM1
• Gene ID: 6722
• mRNA Refseq: NM_003131
• Protein Refseq: NP_003122
• MIM: 600589
• Uniprot ID: P11831
• Chromosome Location: 6p
• Pathway: Coregulation of Androgen receptor activity, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Heart Development, organism-specific biosystem
• Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription; contributes_to RNA polymerase II core promoter sequence-specific DNA binding transcription factor