Recombinant Human SS18
Cat.No. : | SS18-30032TH |
Product Overview : | Recombinant fragment of Human SS18 with N terminal proprietary tag. Predicted MW 36.74 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 101 amino acids |
Description : | Protein SSXT is a protein that in humans is encoded by the SS18 gene. |
Molecular Weight : | 36.740kDa inclusive of tags |
Tissue specificity : | Fairly ubiquitously expressed. Expressed in synovial sarcomas and in other human cell lines. The fusion genes SSXT-SSX1 and SSXT-SSX2 are expressed only in synovial sarcomas. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | APHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYN |
Sequence Similarities : | Belongs to the SS18 family. |
Gene Name | SS18 synovial sarcoma translocation, chromosome 18 [ Homo sapiens ] |
Official Symbol | SS18 |
Synonyms | SS18; synovial sarcoma translocation, chromosome 18; SSXT; protein SSXT; SYT; |
Gene ID | 6760 |
mRNA Refseq | NM_005637 |
Protein Refseq | NP_005628 |
MIM | 600192 |
Uniprot ID | Q15532 |
Chromosome Location | 18q11.2 |
Pathway | Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem; |
Function | ligand-dependent nuclear receptor transcription coactivator activity; protein binding; |
◆ Recombinant Proteins | ||
SS18-8431Z | Recombinant Zebrafish SS18 | +Inquiry |
SS18-4481R | Recombinant Rhesus monkey SS18 Protein, His-tagged | +Inquiry |
SS18-5399C | Recombinant Chicken SS18 | +Inquiry |
SS18-29991TH | Recombinant Human SS18 | +Inquiry |
SS18-496HF | Recombinant Full Length Human SS18 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SS18-1468HCL | Recombinant Human SS18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SS18 Products
Required fields are marked with *
My Review for All SS18 Products
Required fields are marked with *