"SS18" Related Products

Expand

Recombinant Human SS18

Cat.No.: SS18-30032TH
Product Overview: Recombinant fragment of Human SS18 with N terminal proprietary tag. Predicted MW 36.74 kDa.
Description: Protein SSXT is a protein that in humans is encoded by the SS18 gene.
Protein length: 101 amino acids
Molecular Weight: 36.740kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Fairly ubiquitously expressed. Expressed in synovial sarcomas and in other human cell lines. The fusion genes SSXT-SSX1 and SSXT-SSX2 are expressed only in synovial sarcomas.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: APHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYN
Sequence Similarities: Belongs to the SS18 family.
Gene Name: SS18 synovial sarcoma translocation, chromosome 18 [ Homo sapiens ]
Official Symbol: SS18
Synonyms: SS18; synovial sarcoma translocation, chromosome 18; SSXT; protein SSXT; SYT;
Gene ID: 6760
mRNA Refseq: NM_005637
Protein Refseq: NP_005628
MIM: 600192
Uniprot ID: Q15532
Chromosome Location: 18q11.2
Pathway: Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;
Function: ligand-dependent nuclear receptor transcription coactivator activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.