Recombinant Human SS18 protein, His-tagged
| Cat.No. : | SS18-3860H |
| Product Overview : | Recombinant Human SS18 protein(1-60 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-60 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVY |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SS18 synovial sarcoma translocation, chromosome 18 [ Homo sapiens ] |
| Official Symbol | SS18 |
| Synonyms | SS18; synovial sarcoma translocation, chromosome 18; SSXT; protein SSXT; SYT; synovial sarcoma, translocated to X chromosome; synovial sarcoma translocated to X chromosome protein; MGC116875; |
| Gene ID | 6760 |
| mRNA Refseq | NM_001007559 |
| Protein Refseq | NP_001007560 |
| MIM | 600192 |
| UniProt ID | Q15532 |
| ◆ Recombinant Proteins | ||
| SS18-29991TH | Recombinant Human SS18 | +Inquiry |
| SS18-4481R | Recombinant Rhesus monkey SS18 Protein, His-tagged | +Inquiry |
| SS18-8431Z | Recombinant Zebrafish SS18 | +Inquiry |
| SS18-3519C | Recombinant Chicken SS18 | +Inquiry |
| SS18-5399C | Recombinant Chicken SS18 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SS18-1468HCL | Recombinant Human SS18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SS18 Products
Required fields are marked with *
My Review for All SS18 Products
Required fields are marked with *
