Recombinant Human SSRP1, His-tagged
Cat.No. : | SSRP1-29276TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 274-709 of Human SSRP1 with an N terminal His tag. Predicted MWt: 51 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 274-709 a.a. |
Description : | The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 133 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ILLFSKDEDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEM VSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGL LYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNAKKLNIKNRG LKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENA NDSSDDSGEETDESFNPGEEEEDVAEEFDSNASASSSSNE GDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPN APKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGE IWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSK RDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESFK SKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPS SEDSASGSDE |
Gene Name | SSRP1 structure specific recognition protein 1 [ Homo sapiens ] |
Official Symbol | SSRP1 |
Synonyms | SSRP1; structure specific recognition protein 1; FACT complex subunit SSRP1; facilitates chromatin remodeling 80 kDa subunit; FACT80; |
Gene ID | 6749 |
mRNA Refseq | NM_003146 |
Protein Refseq | NP_003137 |
MIM | 604328 |
Uniprot ID | Q08945 |
Chromosome Location | 11q12 |
Pathway | Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; Gene Expression, organism-specific biosystem; |
Function | DNA binding; protein binding; |
◆ Recombinant Proteins | ||
SSRP1-1250C | Recombinant Chicken SSRP1 | +Inquiry |
SSRP1-4492R | Recombinant Rhesus monkey SSRP1 Protein, His-tagged | +Inquiry |
SSRP1-5417R | Recombinant Rat SSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SSRP1-1181H | Recombinant Human SSRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SSRP1-3521H | Recombinant Human SSRP1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSRP1-1456HCL | Recombinant Human SSRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SSRP1 Products
Required fields are marked with *
My Review for All SSRP1 Products
Required fields are marked with *