"SSRP1" Related Products

Expand

Recombinant Human SSRP1, His-tagged

Cat.No.: SSRP1-29276TH
Product Overview: Recombinant fragment, corresponding to amino acids 274-709 of Human SSRP1 with an N terminal His tag. Predicted MWt: 51 kDa;
Description: The protein encoded by this gene is a subunit of a heterodimer that, along with SUPT16H, forms chromatin transcriptional elongation factor FACT. FACT interacts specifically with histones H2A/H2B to effect nucleosome disassembly and transcription elongation. FACT and cisplatin-damaged DNA may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified DNA. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 133 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: ILLFSKDEDISLTLNMNEEEVEKRFEGRLTKNMSGSLYEM VSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGL LYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNAKKLNIKNRG LKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENA NDSSDDSGEETDESFNPGEEEEDVAEEFDSNASASSSSNE GDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPN APKRPMSAYMLWLNASREKIKSDHPGISITDLSKKAGE IWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGGRGESSK RDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESFK SKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPS SEDSASGSDE
Gene Name: SSRP1 structure specific recognition protein 1 [ Homo sapiens ]
Official Symbol: SSRP1
Synonyms: SSRP1; structure specific recognition protein 1; FACT complex subunit SSRP1; facilitates chromatin remodeling 80 kDa subunit; FACT80;
Gene ID: 6749
mRNA Refseq: NM_003146
Protein Refseq: NP_003137
MIM: 604328
Uniprot ID: Q08945
Chromosome Location: 11q12
Pathway: Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; Gene Expression, organism-specific biosystem;
Function: DNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.