"STOML2" Related Products

Expand

Recombinant Human STOML2, His-tagged

Cat.No.: STOML2-31473TH
Product Overview: Recombinant fragment, corresponding to amino acids 25-356 of Human STOML2 with N terminal His tag; Predicted MWt 37 kDa.
Description: STOML2 is similar in sequence to stomatin. It is a 356 amino acid protein with a calculated molecular mass of 38.5 kDa. STOML2 has 3 potential initiator sites, all sharing the same open reading frame. The STOML2 protein contains the cognate stomatin family consensus sequence, but it lacks the characteristic N-terminal hydrophobic domain and palmitoylation consensus sequence. STOML2 shares greatest sequence homology with stomatin and SLP1 in a region predicted to contain beta sheet and alpha helix structures. Northern blot analysis detected a 1.5 kb STOML2 transcript in all tissues examined, with highest levels in heart, liver, and pancreas. Western blot analysis detected STOML2 at apparent molecular masses of 45.5 kDa or 44.6 kDa in all human and mammalian cell lines and tissues examined, including red blood cells. Some cells also showed a faint band at about 34.3 kDa, which may represent translation from an alternate initiation site.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 164 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLN ILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQID GVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGK LSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIK DIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVA EGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAE AIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSN TILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLS SGSSRDVQGTDASLDEELDRVKMS
Gene Name: STOML2 stomatin (EPB72)-like 2 [ Homo sapiens ]
Official Symbol: STOML2
Synonyms: STOML2; stomatin (EPB72)-like 2; stomatin-like protein 2; HSPC108; SLP 2;
Gene ID: 30968
mRNA Refseq: NM_013442
Protein Refseq: NP_038470
MIM: 608292
Uniprot ID: Q9UJZ1
Chromosome Location: 9p13.1
Function: receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.