Recombinant Human STOML2, His-tagged

Cat.No. : STOML2-31473TH
Product Overview : Recombinant fragment, corresponding to amino acids 25-356 of Human STOML2 with N terminal His tag; Predicted MWt 37 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 25-356 a.a.
Description : STOML2 is similar in sequence to stomatin. It is a 356 amino acid protein with a calculated molecular mass of 38.5 kDa. STOML2 has 3 potential initiator sites, all sharing the same open reading frame. The STOML2 protein contains the cognate stomatin family consensus sequence, but it lacks the characteristic N-terminal hydrophobic domain and palmitoylation consensus sequence. STOML2 shares greatest sequence homology with stomatin and SLP1 in a region predicted to contain beta sheet and alpha helix structures. Northern blot analysis detected a 1.5 kb STOML2 transcript in all tissues examined, with highest levels in heart, liver, and pancreas. Western blot analysis detected STOML2 at apparent molecular masses of 45.5 kDa or 44.6 kDa in all human and mammalian cell lines and tissues examined, including red blood cells. Some cells also showed a faint band at about 34.3 kDa, which may represent translation from an alternate initiation site.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 164 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLN ILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQID GVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGK LSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIK DIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVA EGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAE AIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSN TILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLS SGSSRDVQGTDASLDEELDRVKMS
Gene Name STOML2 stomatin (EPB72)-like 2 [ Homo sapiens ]
Official Symbol STOML2
Synonyms STOML2; stomatin (EPB72)-like 2; stomatin-like protein 2; HSPC108; SLP 2;
Gene ID 30968
mRNA Refseq NM_013442
Protein Refseq NP_038470
MIM 608292
Uniprot ID Q9UJZ1
Chromosome Location 9p13.1
Function receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All STOML2 Products

Required fields are marked with *

My Review for All STOML2 Products

Required fields are marked with *

0
cart-icon