Recombinant Human STOML2, His-tagged
Cat.No. : | STOML2-31473TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 25-356 of Human STOML2 with N terminal His tag; Predicted MWt 37 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-356 a.a. |
Description : | STOML2 is similar in sequence to stomatin. It is a 356 amino acid protein with a calculated molecular mass of 38.5 kDa. STOML2 has 3 potential initiator sites, all sharing the same open reading frame. The STOML2 protein contains the cognate stomatin family consensus sequence, but it lacks the characteristic N-terminal hydrophobic domain and palmitoylation consensus sequence. STOML2 shares greatest sequence homology with stomatin and SLP1 in a region predicted to contain beta sheet and alpha helix structures. Northern blot analysis detected a 1.5 kb STOML2 transcript in all tissues examined, with highest levels in heart, liver, and pancreas. Western blot analysis detected STOML2 at apparent molecular masses of 45.5 kDa or 44.6 kDa in all human and mammalian cell lines and tissues examined, including red blood cells. Some cells also showed a faint band at about 34.3 kDa, which may represent translation from an alternate initiation site. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 164 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLN ILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQID GVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGK LSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIK DIHVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVA EGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAE AIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSN TILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLS SGSSRDVQGTDASLDEELDRVKMS |
Gene Name | STOML2 stomatin (EPB72)-like 2 [ Homo sapiens ] |
Official Symbol | STOML2 |
Synonyms | STOML2; stomatin (EPB72)-like 2; stomatin-like protein 2; HSPC108; SLP 2; |
Gene ID | 30968 |
mRNA Refseq | NM_013442 |
Protein Refseq | NP_038470 |
MIM | 608292 |
Uniprot ID | Q9UJZ1 |
Chromosome Location | 9p13.1 |
Function | receptor binding; |
◆ Recombinant Proteins | ||
STOML2-4533R | Recombinant Rhesus monkey STOML2 Protein, His-tagged | +Inquiry |
STOML2-5458R | Recombinant Rat STOML2 Protein, His (Fc)-Avi-tagged | +Inquiry |
STOML2-3178H | Recombinant Human STOML2 Protein, His-tagged | +Inquiry |
STOML2-318H | Recombinant Human STOML2 protein, GST-tagged | +Inquiry |
STOML2-4349R | Recombinant Rhesus Macaque STOML2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STOML2-1391HCL | Recombinant Human STOML2 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STOML2 Products
Required fields are marked with *
My Review for All STOML2 Products
Required fields are marked with *
0
Inquiry Basket