Recombinant Human SUPT4H1
Cat.No. : | SUPT4H1-31480TH |
Product Overview : | Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene. |
Protein length : | 117 amino acids |
Molecular Weight : | 38.940kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT |
Sequence Similarities : | Belongs to the SPT4 family. |
Gene Name : | SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol : | SUPT4H1 |
Synonyms : | SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H; |
Gene ID : | 6827 |
mRNA Refseq : | NM_003168 |
Protein Refseq : | NP_003159 |
MIM : | 603555 |
Uniprot ID : | P63272 |
Chromosome Location : | 17q21-q23 |
Pathway : | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
Function : | metal ion binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
SUPT4H1-735C | Recombinant Cynomolgus Monkey SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUPT4H1-4380R | Recombinant Rhesus Macaque SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUPT4H1-8877M | Recombinant Mouse SUPT4H1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SUPT4H1-16247M | Recombinant Mouse SUPT4H1 Protein | +Inquiry |
SUPT4H1-4612C | Recombinant Chicken SUPT4H1 | +Inquiry |
◆ Lysates | ||
SUPT4H1-1338HCL | Recombinant Human SUPT4H1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket