"SUPT4H1" Related Products

Expand
Expand

Recombinant Human SUPT4H1

Cat.No.: SUPT4H1-31480TH
Product Overview: Recombinant full length Human Suppressor of Ty 4 homolog 1 with N terminal proprietary tag; Predicted MWt 38.94 kDa.
Description: Transcription elongation factor SPT4 is a protein that in humans is encoded by the SUPT4H1 gene.
Protein length: 117 amino acids
Molecular Weight: 38.940kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Widely expressed.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYL QMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNF KPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
Sequence Similarities: Belongs to the SPT4 family.
Gene Name: SUPT4H1 suppressor of Ty 4 homolog 1 (S. cerevisiae) [ Homo sapiens ]
Official Symbol: SUPT4H1
Synonyms: SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1 , SUPT4H; transcription elongation factor SPT4; SPT4H;
Gene ID: 6827
mRNA Refseq: NM_003168
Protein Refseq: NP_003159
MIM: 603555
Uniprot ID: P63272
Chromosome Location: 17q21-q23
Pathway: Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem;
Function: metal ion binding; protein binding; protein heterodimerization activity; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.