Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human TAX1BP3, His-tagged

Cat.No. : TAX1BP3-28609TH
Product Overview : Recombinant full length Human TAX1BP3 with an N terminal His tag; 144 amino acids with a predicted MWt of 15.8 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
Description : Tax1-binding protein 3 is a protein that in humans is encoded by the TAX1BP3 gene.
Protein length : 124 amino acids
Conjugation : HIS
Molecular Weight : 15.800kDa inclusive of tags
Source : E. coli
Tissue specificity : Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHK LRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR SEEVVRLLVTRQSLQKAVQQSMLS
Sequence Similarities : Contains 1 PDZ (DHR) domain.
Gene Name : TAX1BP3 Tax1 (human T-cell leukemia virus type I) binding protein 3 [ Homo sapiens ]
Official Symbol : TAX1BP3
Synonyms : TAX1BP3; Tax1 (human T-cell leukemia virus type I) binding protein 3; tax1-binding protein 3; Tax interaction protein 1; TIP 1;
Gene ID : 30851
mRNA Refseq : NM_001204698
Protein Refseq : NP_001191627
Uniprot ID : O14907
Chromosome Location : 17p13
Pathway : Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function : beta-catenin binding; protein C-terminus binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All TAX1BP3 Products

Required fields are marked with *

My Review for All TAX1BP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends