"TAX1BP3" Related Products

Expand
Expand

Recombinant Human TAX1BP3, His-tagged

Cat.No.: TAX1BP3-28609TH
Product Overview: Recombinant full length Human TAX1BP3 with an N terminal His tag; 144 amino acids with a predicted MWt of 15.8 kDa including the tag.
Description: Tax1-binding protein 3 is a protein that in humans is encoded by the TAX1BP3 gene.
Protein length: 124 amino acids
Conjugation: HIS
Molecular Weight: 15.800kDa inclusive of tags
Source: E. coli
Tissue specificity: Detected in various cell lines including HeLa. Weakly expressed in peripheral blood leukocytes.
Form: Liquid
Purity: >95% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSYIPGQPVTAVVQRVEIHK LRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKR SEEVVRLLVTRQSLQKAVQQSMLS
Sequence Similarities: Contains 1 PDZ (DHR) domain.
Gene Name: TAX1BP3 Tax1 (human T-cell leukemia virus type I) binding protein 3 [ Homo sapiens ]
Official Symbol: TAX1BP3
Synonyms: TAX1BP3; Tax1 (human T-cell leukemia virus type I) binding protein 3; tax1-binding protein 3; Tax interaction protein 1; TIP 1;
Gene ID: 30851
mRNA Refseq: NM_001204698
Protein Refseq: NP_001191627
Uniprot ID: O14907
Chromosome Location: 17p13
Pathway: Wnt Signaling Pathway NetPath, organism-specific biosystem;
Function: beta-catenin binding; protein C-terminus binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.