Recombinant Human TBCB

Cat.No. : TBCB-27999TH
Product Overview : Recombinant fragment of Human CKAP1 with N-terminal proprietary tag. Predicted MW 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Molecular Weight : 36.630kDa inclusive of tags
Tissue specificity : Found in most tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL
Sequence Similarities : Belongs to the TBCB family.Contains 1 CAP-Gly domain.
Gene Name TBCB tubulin folding cofactor B [ Homo sapiens ]
Official Symbol TBCB
Synonyms TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1 , cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI;
Gene ID 1155
mRNA Refseq NM_001281
Protein Refseq NP_001272
MIM 601303
Uniprot ID Q99426
Chromosome Location 19q13.11-q13.12
Pathway Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBCB Products

Required fields are marked with *

My Review for All TBCB Products

Required fields are marked with *

0
cart-icon