"TBCB" Related Products

Expand
Expand

Recombinant Human TBCB

Cat.No.: TBCB-27999TH
Product Overview: Recombinant fragment of Human CKAP1 with N-terminal proprietary tag. Predicted MW 36.63 kDa.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Found in most tissues.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL
Sequence Similarities: Belongs to the TBCB family.Contains 1 CAP-Gly domain.
Gene Name: TBCB tubulin folding cofactor B [ Homo sapiens ]
Official Symbol: TBCB
Synonyms: TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1 , cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI;
Gene ID: 1155
mRNA Refseq: NM_001281
Protein Refseq: NP_001272
MIM: 601303
Uniprot ID: Q99426
Chromosome Location: 19q13.11-q13.12
Pathway: Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function: protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.