Recombinant Human TBCB
Cat.No. : | TBCB-27999TH |
Product Overview : | Recombinant fragment of Human CKAP1 with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Found in most tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL |
Sequence Similarities : | Belongs to the TBCB family.Contains 1 CAP-Gly domain. |
Gene Name | TBCB tubulin folding cofactor B [ Homo sapiens ] |
Official Symbol | TBCB |
Synonyms | TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1 , cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI; |
Gene ID | 1155 |
mRNA Refseq | NM_001281 |
Protein Refseq | NP_001272 |
MIM | 601303 |
Uniprot ID | Q99426 |
Chromosome Location | 19q13.11-q13.12 |
Pathway | Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
TBCB-16504M | Recombinant Mouse TBCB Protein | +Inquiry |
TBCB-9042M | Recombinant Mouse TBCB Protein, His (Fc)-Avi-tagged | +Inquiry |
TBCB-27999TH | Recombinant Human TBCB | +Inquiry |
TBCB-6220H | Recombinant Human TBCB Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TBCB-12043Z | Recombinant Zebrafish TBCB | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCB-1219HCL | Recombinant Human TBCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TBCB Products
Required fields are marked with *
My Review for All TBCB Products
Required fields are marked with *
0
Inquiry Basket