Recombinant Human TBCB
| Cat.No. : | TBCB-27999TH |
| Product Overview : | Recombinant fragment of Human CKAP1 with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 100 amino acids |
| Molecular Weight : | 36.630kDa inclusive of tags |
| Tissue specificity : | Found in most tissues. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | SLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL |
| Sequence Similarities : | Belongs to the TBCB family.Contains 1 CAP-Gly domain. |
| Gene Name | TBCB tubulin folding cofactor B [ Homo sapiens ] |
| Official Symbol | TBCB |
| Synonyms | TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1 , cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI; |
| Gene ID | 1155 |
| mRNA Refseq | NM_001281 |
| Protein Refseq | NP_001272 |
| MIM | 601303 |
| Uniprot ID | Q99426 |
| Chromosome Location | 19q13.11-q13.12 |
| Pathway | Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem; |
| Function | protein binding; |
| ◆ Recombinant Proteins | ||
| TBCB-565H | Recombinant Human TBCB protein(Met1-Ile244), His-tagged | +Inquiry |
| TBCB-9042M | Recombinant Mouse TBCB Protein, His (Fc)-Avi-tagged | +Inquiry |
| TBCB-6833H | Recombinant Human Tubulin Folding Cofactor B, His-tagged | +Inquiry |
| TBCB-27999TH | Recombinant Human TBCB | +Inquiry |
| TBCB-16504M | Recombinant Mouse TBCB Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TBCB-1219HCL | Recombinant Human TBCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBCB Products
Required fields are marked with *
My Review for All TBCB Products
Required fields are marked with *
