Recombinant Human TBCC
Cat.No. : | TBCC-29834TH |
Product Overview : | Recombinant full length Human TBCC with N terminal proprietary tag, 64.17 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cofactor C is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. |
Protein length : | 346 amino acids |
Molecular Weight : | 64.170kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEV ERRKQKRQNQEVEKENSHFFVATFARERAAVEELLERAES VERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARL QAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPP AVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASE LHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPV STSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDD FNWLARDMASPNWSILPEEERNIQWD |
Gene Name : | TBCC tubulin folding cofactor C [ Homo sapiens ] |
Official Symbol : | TBCC |
Synonyms : | TBCC; tubulin folding cofactor C; tubulin specific chaperone c; tubulin-specific chaperone C; CFC; |
Gene ID : | 6903 |
mRNA Refseq : | NM_003192 |
Protein Refseq : | NP_003183 |
MIM : | 602971 |
Uniprot ID : | Q15814 |
Chromosome Location : | 6p21.1 |
Pathway : | Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem; |
Function : | GTPase activity; binding; chaperone binding; |
Products Types
◆ Recombinant Protein | ||
TBCC-825H | Recombinant Human TBCC Protein (2-345 aa), His-tagged | +Inquiry |
TBCC-9043M | Recombinant Mouse TBCC Protein, His (Fc)-Avi-tagged | +Inquiry |
Tbcc-6312M | Recombinant Mouse Tbcc Protein, Myc/DDK-tagged | +Inquiry |
TBCC-8142Z | Recombinant Zebrafish TBCC | +Inquiry |
TBCC-16505M | Recombinant Mouse TBCC Protein | +Inquiry |
◆ Lysates | ||
TBCC-1218HCL | Recombinant Human TBCC 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All TBCC Products
Required fields are marked with *
My Review for All TBCC Products
Required fields are marked with *
0
Inquiry Basket