"TBCC" Related Products

Recombinant Human TBCC

Cat.No.: TBCC-29834TH
Product Overview: Recombinant full length Human TBCC with N terminal proprietary tag, 64.17 kDa.
Description: Cofactor C is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state.
Protein length: 346 amino acids
Molecular Weight: 64.170kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEV ERRKQKRQNQEVEKENSHFFVATFARERAAVEELLERAES VERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARL QAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPP AVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASE LHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPV STSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDD FNWLARDMASPNWSILPEEERNIQWD
Gene Name: TBCC tubulin folding cofactor C [ Homo sapiens ]
Official Symbol: TBCC
Synonyms: TBCC; tubulin folding cofactor C; tubulin specific chaperone c; tubulin-specific chaperone C; CFC;
Gene ID: 6903
mRNA Refseq: NM_003192
Protein Refseq: NP_003183
MIM: 602971
Uniprot ID: Q15814
Chromosome Location: 6p21.1
Pathway: Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem;
Function: GTPase activity; binding; chaperone binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.