Recombinant Human TBCC
Cat.No. : | TBCC-29834TH |
Product Overview : | Recombinant full length Human TBCC with N terminal proprietary tag, 64.17 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 346 amino acids |
Description : | Cofactor C is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. |
Molecular Weight : | 64.170kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEV ERRKQKRQNQEVEKENSHFFVATFARERAAVEELLERAES VERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARL QAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPP AVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASE LHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPV STSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDD FNWLARDMASPNWSILPEEERNIQWD |
Gene Name | TBCC tubulin folding cofactor C [ Homo sapiens ] |
Official Symbol | TBCC |
Synonyms | TBCC; tubulin folding cofactor C; tubulin specific chaperone c; tubulin-specific chaperone C; CFC; |
Gene ID | 6903 |
mRNA Refseq | NM_003192 |
Protein Refseq | NP_003183 |
MIM | 602971 |
Uniprot ID | Q15814 |
Chromosome Location | 6p21.1 |
Pathway | Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem; |
Function | GTPase activity; binding; chaperone binding; |
◆ Recombinant Proteins | ||
TBCC-3862H | Recombinant Human TBCC protein, His-tagged | +Inquiry |
TBCC-825H | Recombinant Human TBCC Protein (2-345 aa), His-tagged | +Inquiry |
TBCC-16505M | Recombinant Mouse TBCC Protein | +Inquiry |
TBCC-29834TH | Recombinant Human TBCC | +Inquiry |
TBCC-8142Z | Recombinant Zebrafish TBCC | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBCC-1218HCL | Recombinant Human TBCC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBCC Products
Required fields are marked with *
My Review for All TBCC Products
Required fields are marked with *