Recombinant Full Length Human TBCC Protein
Cat.No. : | TBCC-518HF |
Product Overview : | Recombinant full length Human TBCC with N terminal proprietary tag, 64.17 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Cofactor C is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 64.170kDa inclusive of tags |
Protein Length : | 346 amino acids |
AA Sequence : | MESVSCSAAAVRTGDMESQRDLSLVPERLQRREQERQLEV ERRKQKRQNQEVEKENSHFFVATFARERAAVEELLERAES VERLEEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARL QAALAERRRGLQPKKRFAFKTRGKDAASSTKVDAAPGIPP AVESIQDSPLPKKAEGDLGPSWVCGFSNLESQVLEKRASE LHQRDVLLTELSNCTVRLYGNPNTLRLTKAHSCKLLCGPV STSVFLEDCSDCVLAVACQQLRIHSTKDTRIFLQVTSRAI VEDCSGIQFAPYTWSYPEIDKDFESSGLDRSKNNWNDVDD FNWLARDMASPNWSILPEEERNIQWD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | TBCC tubulin folding cofactor C [ Homo sapiens ] |
Official Symbol : | TBCC |
Synonyms : | TBCC; tubulin folding cofactor C; tubulin specific chaperone c; tubulin-specific chaperone C; CFC |
Gene ID : | 6903 |
mRNA Refseq : | NM_003192 |
Protein Refseq : | NP_003183 |
MIM : | 602971 |
UniProt ID : | Q15814 |
Products Types
◆ Recombinant Protein | ||
Tbcc-6312M | Recombinant Mouse Tbcc Protein, Myc/DDK-tagged | +Inquiry |
TBCC-825H | Recombinant Human TBCC Protein (2-345 aa), His-tagged | +Inquiry |
TBCC-9043M | Recombinant Mouse TBCC Protein, His (Fc)-Avi-tagged | +Inquiry |
TBCC-3862H | Recombinant Human TBCC protein, His-tagged | +Inquiry |
TBCC-8142Z | Recombinant Zebrafish TBCC | +Inquiry |
◆ Lysates | ||
TBCC-1218HCL | Recombinant Human TBCC 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket