"THOC3" Related Products

Expand

Recombinant Human THOC3, His-tagged

Cat.No.: THOC3-29515TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-351 of Human THOC3 with N terminal His tag, 43kDa.
Description: TEX1 is part of the TREX (transcription/export) complex, which includes THO2 (MIM 300395), HPR1 (MIM 606930), ALY (MIM 604171), and UAP56 (MIM 142560).
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 125 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQE LFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKT ASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTA SGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTI AVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDN NMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDP MGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTL SFSHDGKMLASASEDHFIDIAEVETGDKLWEVQCESPT FTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPND S
Gene Name: THOC3 THO complex 3 [ Homo sapiens ]
Official Symbol: THOC3
Synonyms: THOC3; THO complex 3; THO complex subunit 3; MGC5469; TEX1;
Gene ID: 84321
mRNA Refseq: NM_032361
Protein Refseq: NP_115737
MIM: 606929
Uniprot ID: Q96J01
Chromosome Location: 5q35.3
Pathway: RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; TREX complex, organism-specific biosystem;
Function: RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.