"TMSB4X" Related Products

Expand
Expand

Recombinant Human TMSB4X

Cat.No.: TMSB4X-30407TH
Product Overview: Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa;.
Description: This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y.
Protein length: 44 amino acids
Molecular Weight: 30.840kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence Similarities: Belongs to the thymosin beta family.
Gene Name: TMSB4X thymosin beta 4, X-linked [ Homo sapiens ]
Official Symbol: TMSB4X
Synonyms: TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X;
Gene ID: 7114
mRNA Refseq: NM_021109
Protein Refseq: NP_066932
MIM: 300159
Uniprot ID: P62328
Chromosome Location: Xq21.3-q22
Pathway: Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem;
Function: actin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.