Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human TMSB4X

Cat.No. : TMSB4X-30407TH
Product Overview : Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa;.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y.
Protein length : 44 amino acids
Molecular Weight : 30.840kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Sequence Similarities : Belongs to the thymosin beta family.
Gene Name : TMSB4X thymosin beta 4, X-linked [ Homo sapiens ]
Official Symbol : TMSB4X
Synonyms : TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X;
Gene ID : 7114
mRNA Refseq : NM_021109
Protein Refseq : NP_066932
MIM : 300159
Uniprot ID : P62328
Chromosome Location : Xq21.3-q22
Pathway : Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem;
Function : actin binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends