Recombinant Human TMSB4X
Cat.No. : | TMSB4X-30407TH |
Product Overview : | Recombinant full length Human Thymosin beta 4 with a proprietary tag; predicted mwt: 30.84 kDa;. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 44 amino acids |
Description : | This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. |
Molecular Weight : | 30.840kDa inclusive of tags |
Tissue specificity : | Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES |
Sequence Similarities : | Belongs to the thymosin beta family. |
Gene Name | TMSB4X thymosin beta 4, X-linked [ Homo sapiens ] |
Official Symbol | TMSB4X |
Synonyms | TMSB4X; thymosin beta 4, X-linked; thymosin, beta 4, X chromosome , TMSB4; thymosin beta-4; TB4X; |
Gene ID | 7114 |
mRNA Refseq | NM_021109 |
Protein Refseq | NP_066932 |
MIM | 300159 |
Uniprot ID | P62328 |
Chromosome Location | Xq21.3-q22 |
Pathway | Hemostasis, organism-specific biosystem; Platelet activation, signaling and aggregation, organism-specific biosystem; Platelet degranulation, organism-specific biosystem; Regulation of Actin Cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; |
Function | actin binding; protein binding; |
◆ Recombinant Proteins | ||
TMSB4X-891H | Recombinant Human TMSB4X Protein | +Inquiry |
TMSB4X-9459M | Recombinant Mouse TMSB4X Protein, His (Fc)-Avi-tagged | +Inquiry |
TMSB4X-7168H | Recombinant Human TMSB4X protein, His-tagged | +Inquiry |
TMSB4X-6189R | Recombinant Rat TMSB4X Protein | +Inquiry |
TMSB4X-1095C | Recombinant Chicken TMSB4X | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMSB4X-904HCL | Recombinant Human TMSB4X 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMSB4X Products
Required fields are marked with *
My Review for All TMSB4X Products
Required fields are marked with *
0
Inquiry Basket