"TRIM37" Related Products

Recombinant Human TRIM37

Cat.No.: TRIM37-31610TH
Product Overview: Recombinant fragment of Human TRIM37 with an N-terminal proprietary tag; Predicted MW 36.63 kDa
Description: This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif and a coiled-coil domain. The RING finger and B-box domains chelate zinc and might be involved in protein-protein and/or protein-nucleic acid interactions. The gene mutations are associated with mulibrey (muscle-liver-brain-eye) nanism, an autosomal recessive disorder that involves several tissues of mesodermal origin. Alternatively spliced transcript variants encoding the same protein have been identified.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR
Sequence Similarities: Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 MATH domain.Contains 1 RING-type zinc finger.
Gene Name: TRIM37 tripartite motif containing 37 [ Homo sapiens ]
Official Symbol: TRIM37
Synonyms: TRIM37; tripartite motif containing 37; MUL, tripartite motif containing 37; E3 ubiquitin-protein ligase TRIM37; KIAA0898; POB1; RING B box coiled coil protein; TEF3;
Gene ID: 4591
mRNA Refseq: NM_001005207
Protein Refseq: NP_001005207
MIM: 605073
Uniprot ID: O94972
Chromosome Location: 17q
Pathway: Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem;
Function: ligase activity; metal ion binding; protein binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.