Recombinant Human TRIM37
Cat.No. : | TRIM37-31610TH |
Product Overview : | Recombinant fragment of Human TRIM37 with an N-terminal proprietary tag; Predicted MW 36.63 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif and a coiled-coil domain. The RING finger and B-box domains chelate zinc and might be involved in protein-protein and/or protein-nucleic acid interactions. The gene mutations are associated with mulibrey (muscle-liver-brain-eye) nanism, an autosomal recessive disorder that involves several tissues of mesodermal origin. Alternatively spliced transcript variants encoding the same protein have been identified. |
Molecular Weight : | 36.630kDa inclusive of tags |
Tissue specificity : | Ubiquitous. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR |
Sequence Similarities : | Belongs to the TRIM/RBCC family.Contains 1 B box-type zinc finger.Contains 1 MATH domain.Contains 1 RING-type zinc finger. |
Gene Name | TRIM37 tripartite motif containing 37 [ Homo sapiens ] |
Official Symbol | TRIM37 |
Synonyms | TRIM37; tripartite motif containing 37; MUL, tripartite motif containing 37; E3 ubiquitin-protein ligase TRIM37; KIAA0898; POB1; RING B box coiled coil protein; TEF3; |
Gene ID | 4591 |
mRNA Refseq | NM_001005207 |
Protein Refseq | NP_001005207 |
MIM | 605073 |
Uniprot ID | O94972 |
Chromosome Location | 17q |
Pathway | Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; |
Function | ligase activity; metal ion binding; protein binding; zinc ion binding; |
◆ Recombinant Proteins | ||
TRIM37-640H | Active Recombinant Human TRIM37 Protein, GST-tagged | +Inquiry |
TRIM37-1372C | Recombinant Chicken TRIM37 | +Inquiry |
TRIM37-199H | Recombinant Human TRIM37, GST-tagged | +Inquiry |
TRIM37-31610TH | Recombinant Human TRIM37 | +Inquiry |
TRIM37-4966R | Recombinant Rhesus monkey TRIM37 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM37-780HCL | Recombinant Human TRIM37 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRIM37 Products
Required fields are marked with *
My Review for All TRIM37 Products
Required fields are marked with *